SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000023861 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000023861
Domain Number 1 Region: 108-183
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.00000000000000157
Family HLH, helix-loop-helix DNA-binding domain 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000023861   Gene: ENSPTRG00000013863   Transcript: ENSPTRT00000025852
Sequence length 323
Comment pep:known_by_projection chromosome:CHIMP2.1.4:21:19129143:19132409:1 gene:ENSPTRG00000013863 transcript:ENSPTRT00000025852 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDSDASLVSSRPSSPEPDDLFLPARSKGSSGSAFTGGTVSSSTPSDCPPELSAELRGAMG
SAGAHPGDKLGGSGFKSSSSSTSSSTSSAAASSTKKDKKQMTEPELQQLRLKINSRERKR
MHDLNIAMDGLREVMPYAHGPSVRKLSKIATLLLARNYILMLTNSLEEMKRLVSEIYGGH
HAGFHPSACGGLAHSAPLPAATAHPAAAAHAAHHPAVHHPILPPAAAAAAAAAAAAAVSS
ASLPGSGLPSVGSIRPPHGLLKSPSAAAAAPLGGGGGGSGASGGFQHWGGMPCPCSMCQV
PPPHHHVSAMGAGSLPRLTSDAK
Download sequence
Identical sequences A0A2I3RXT7 H2P2Z9 Q13516
ENSPPYP00000012690 ENSPPYP00000012690 ENSPTRP00000023861 ENSP00000331040 ENSP00000371794 ENSPTRP00000023861 ENSP00000331040 ENSP00000371794 ENSP00000331040 NP_005797.1.87134 NP_005797.1.92137 XP_005260965.1.92137 XP_009232162.1.23681 XP_016802659.1.37143 gi|17978475|ref|NP_005797.1| 9598.ENSPTRP00000023861 9600.ENSPPYP00000012690 9606.ENSP00000331040

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]