SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000024512 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000024512
Domain Number 1 Region: 2-60
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.89e-18
Family HkH motif-containing C2H2 finger 0.044
Further Details:      
 
Domain Number 2 Region: 54-78
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.00000366
Family CCCH zinc finger 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000024512   Gene: ENSPTRG00000014229   Transcript: ENSPTRT00000026595
Sequence length 170
Comment pep:known chromosome:CHIMP2.1.4:22:28405989:28444398:-1 gene:ENSPTRG00000014229 transcript:ENSPTRT00000026595 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGKRYFCDYCDRSFQDNLHNRKKHLNGLQHLKAKKVWYDMFRDAAAILLDEQNKRPCRKF
LLTGQCDFGSNCRFSHMSERDLQELSIQVEEERRAREWLLDAPELPKGHLEDWLEKRAKR
LSSAPSSRAEPIRTTVFQYPVGWPPVQELPPSLRAPPPGGWPLQPRVQWG
Download sequence
Identical sequences K6ZA12
ENSPTRP00000024512 ENSPTRP00000024512 9598.ENSPTRP00000024512

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]