SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000024695 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000024695
Domain Number 1 Region: 5-130
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.18e-46
Family Galectin (animal S-lectin) 0.000000302
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000024695   Gene: ENSPTRG00000014338   Transcript: ENSPTRT00000026792
Sequence length 132
Comment pep:known_by_projection chromosome:CHIMP2.1.4:22:36212660:36222477:-1 gene:ENSPTRG00000014338 transcript:ENSPTRT00000026792 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTGELEVKNMDMKPGSTLKITGSIADGTDGFVINLGQGTDKLNLHFNPRFSESIIVCNSL
DGSNWGQEQREDHLCFSPGSEVKFTVTFESDKFKVKLPDGHELTFPNRLGHSHLSYLSIR
GGFNMSSFKLKE
Download sequence
Identical sequences H2QLM3
ENSPTRP00000024695 9598.ENSPTRP00000024695 ENSPTRP00000024695 XP_003821612.1.60992 XP_009436627.1.37143 XP_525588.2.37143

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]