SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000025284 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000025284
Domain Number 1 Region: 201-215,341-602
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 2.1e-63
Family Nuclear receptor ligand-binding domain 0.0000672
Further Details:      
 
Domain Number 2 Region: 132-214
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 8.36e-32
Family Nuclear receptor 0.0000738
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000025284   Gene: ENSPTRG00000014657   Transcript: ENSPTRT00000027420
Sequence length 614
Comment pep:known_by_projection chromosome:CHIMP2.1.4:3:15230095:15270746:1 gene:ENSPTRG00000014657 transcript:ENSPTRT00000027420 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTSPSPRIQIISTDSAVASPQRIQVPATCQWQPCLQPPCCVLIVTDQQTGQKIQIVTAVD
ASGSPKQQFILTSPDGAGTGKVILASPETSSAKQLIFTTSDNLVPGRIQIVTDSASVERL
LGKTDVQRPQVVEYCVVCGDKASGRHYGAVSCEGCKGFFKRSVRKNLTYSCRSNQDCIIN
KHHRNRCQFCRLKKCLEMGMKMESVQSERKPFDVQREKPSNCAASTEKIYIRKDLRSPLI
ATPTFVADKDGARQTGLLDPGMLVNIQQPLIREDGTVLLATDSKAETSQGALGTLANVVT
SLANLSESLNNGDTSEIQPEDQSASEITRAFDTLAKALNTTDSSSSPSLADGIDTSGGGS
IHVISRDQSTPIIEVEGPLLSDTHVTFKLTMPSPMPEYLNVHYICESASRLLFLSMHWAR
SIPAFQALGQDCNTSLVRACWNELFTLGLAQCAQVMSLSTILAAIVNHLQNSIQEDKLSG
DRIKQVMEHIWKLQEFCNSMAKLDIDGYEYAYLKAIVLFSPDHPGLTSTSQIEKFQEKAQ
MELQDYVQKTYSEDTYRLARILVRLPALRLMSSNITEELFFTGLIGNVSIDSIIPYILKM
ETAEYNGQITGASL
Download sequence
Identical sequences ENSPTRP00000025284 ENSPTRP00000025284

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]