SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000025543 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000025543
Domain Number 1 Region: 50-139
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 3.71e-35
Family SCAN domain 0.00011
Further Details:      
 
Domain Number 2 Region: 228-289
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.22e-22
Family KRAB domain (Kruppel-associated box) 0.0013
Further Details:      
 
Domain Number 3 Region: 493-550
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.04e-20
Family Classic zinc finger, C2H2 0.0093
Further Details:      
 
Domain Number 4 Region: 825-877
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.8e-16
Family Classic zinc finger, C2H2 0.0098
Further Details:      
 
Domain Number 5 Region: 711-763
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.37e-16
Family Classic zinc finger, C2H2 0.0088
Further Details:      
 
Domain Number 6 Region: 681-726
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000607
Family Classic zinc finger, C2H2 0.009
Further Details:      
 
Domain Number 7 Region: 539-563,592-618
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000512
Family Classic zinc finger, C2H2 0.023
Further Details:      
 
Domain Number 8 Region: 444-494
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000288
Family Classic zinc finger, C2H2 0.023
Further Details:      
 
Domain Number 9 Region: 605-645
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000235
Family Classic zinc finger, C2H2 0.027
Further Details:      
 
Weak hits

Sequence:  ENSPTRP00000025543
Domain Number - Region: 802-836
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0385
Family Classic zinc finger, C2H2 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000025543   Gene: ENSPTRG00000014817   Transcript: ENSPTRT00000027698
Sequence length 880
Comment pep:known_by_projection chromosome:CHIMP2.1.4:3:45095778:45105189:-1 gene:ENSPTRG00000014817 transcript:ENSPTRT00000027698 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPPGRWHAAYPAQSQSSRERGRLQTVKKEEEDESYTPVQAARPQTLNRPGQELFRQLFRQ
LRYHESSGPLETLSRLRELCRWWLRPDVLSKAQILELLVLEQFLSILPGELRVWVQLHNP
ESGEEAVALLEELQRDLDGTSWRDPGPAQSPDVHWMGTGALRSAQIWSLASPLRSSSALG
DHLEPPYEIEARDFLAGQSDTPAAQMPALFPREGCPGDQVTPTRSLTAQLQETMTFKDVE
VTFSQDEWGWLDSAQRNLYRDVMLENYRNMASLVGPFTKPALISWLEAREPWGLNIQAAQ
PKGNPVAAPTGDDLQSKTNKFILNQEPLEEAETLAVSSGCPATSVSEGIGLRESFQQKSR
QKDQCENPIQVRVKKEETNFSHRTGKDSEVSGSNSLDLKHVTYLRVSGRKESLKHGCGKH
FRMSSHHYDYKKYGKGLRHMIGGFSLHQRIHSGLKGNKKDVCGKDFSLSSHHQRGQSLHT
VGVSFKCSDCGRTFSHSSHLAYHQRLHTQEKAFKCRVCGKAFRWSSNCARHEKIHTGVKP
YKCDLCEKAFRRLSAYRLHRETHAKKKFLELNQYRAALTYSSGFDHHLGDQSGEKLFDCS
QCRKSFHCKSYVLEHQRIPPLEKPYCTKCRKTFRMGSNFTRHMRLLDEDTCDQHECLGSF
RQSPDCRPPHVAPAVEKTFPKISTGEKRFGCQECGKTFTRKRTLLDHKGIHSGEKRYKCN
LCGKSYDRNYRLVNHQRIHSTERPFKCQWCGKEFIGRHTLSSHQRKHTRAAQAERSPPAR
SSSQDTKLRLQKLKPSEEMPLEDCKEACSQSSRLTGLQDISIGKKCHKCSICGKTFNKSS
QLITHKRFHTRERPFKCSKCGKTFRWSSNLARHMKNHIRD
Download sequence
Identical sequences ENSPTRP00000025543 ENSPTRP00000025543

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]