SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000025763 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000025763
Domain Number 1 Region: 181-304
Classification Level Classification E-value
Superfamily Dystroglycan, domain 2 4.97e-60
Family Dystroglycan, domain 2 0.000000302
Further Details:      
 
Domain Number 2 Region: 62-160
Classification Level Classification E-value
Superfamily Cadherin-like 8e-19
Family Dystroglycan, N-terminal domain 0.00000289
Further Details:      
 
Domain Number 3 Region: 497-597
Classification Level Classification E-value
Superfamily Cadherin-like 1.29e-18
Family Dystroglycan, N-terminal domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000025763   Gene: ENSPTRG00000014926   Transcript: ENSPTRT00000027933
Sequence length 895
Comment pep:known chromosome:CHIMP2.1.4:3:50248132:50317324:1 gene:ENSPTRG00000014926 transcript:ENSPTRT00000027933 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRMSVGLSLLLPLWGRTFLLLLSVVMAQSHWPSEPSEAVRDWENQLEASMHSVLSDLHEA
VPTVVGIPDGTAVVGRSFRVTIPTDLIASSGDIIKVSAAGKEALPSWLHWDSQSHILEGL
PLDTDKGVHYISVSATRLGANGSHIPQTSSVFSIEVYPEDHSELQSVRTASPDPGEVVSS
ACAADEPVTVLTVILDADLTKMTPKQRIDLLHRMRSFSEVELHNMKLVPVVNNRLFDMSA
FMAGPGNAKKVVENGALLSWKLGCSLNQNSVPDIRGVEAPAREGAMSAQLGYPVVGWHIA
NKKPPLPKRVRRQIHATPTPVTAIGPPTTAIQEPPSRIVPTPTSPAIAPPTETMAPPVRD
PVPGKPTVTIRTRGAIIQTPTLGPIQPTRVSEAGTTVPGQIRPTMTIPGYVEPTAVATPP
TTTTKKPRVSTPKPATPSTDSTTTTTRRPTKKPRTPRPVPRVTTKVPITRLETASPPTRI
RTTTSGVPRGGEPNQRPELKNHIDRVDAWVGTYFEVKIPSDTFYDHEDTTTDKLKLTLKL
REQQLVGEKSWVQFNSNSQLMYGLPDSSHVGKHEYFMHATDKGGLSAVDAFEIHVHRRPQ
GDRAPARFKAKFVGDPALVLNDIHKKIALVKKLAFAFGDRNCSTITLQNITRGSIVVEWT
NNTLPLEPCPKEQIAGLSRRIAEDDGKPRPAFSNALEPDFKATSIAVTGSGSCRHLQFIP
VVPPRRVPSEAPPTEVPDRDPEKSSEDDVYLHTVIPAVVVAAILLIAGIIAMICYRKKRK
GKLTLEDQATFIKKGVPIIFADELDDSKPPPSSSMPLILQEEKAPLPPPEYPNQSVPETT
PLNQDTVGEYTPLRDEDPNAPPYQPPPPFTAPMEGKGSRPKNMTPYRSPPPYVPP
Download sequence
Identical sequences H2QML8
ENSPTRP00000025763 XP_001164638.1.37143 XP_001164754.1.37143 XP_001164796.1.37143 XP_003339091.1.37143 XP_009443772.1.37143 XP_009443773.1.37143 XP_009443774.1.37143 XP_009443775.1.37143 XP_016796586.1.37143 ENSPTRP00000025763 9598.ENSPTRP00000025763

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]