SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000026312 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000026312
Domain Number 1 Region: 182-469
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 7.47e-97
Family Nuclear receptor ligand-binding domain 0.0000000000388
Further Details:      
 
Domain Number 2 Region: 78-162
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.43e-26
Family Nuclear receptor 0.000086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000026312   Gene: ENSPTRG00000015263   Transcript: ENSPTRT00000028511
Sequence length 473
Comment pep:known_by_projection chromosome:CHIMP2.1.4:3:123151159:123187049:1 gene:ENSPTRG00000015263 transcript:ENSPTRT00000028511 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTVTRTHHFKEGSLRAPATPLHSAAAELASNHPRGPEANLEVRPKESWNHADFVHCEDTE
SVPGKPSVNADEEVGGPQICRVCGDKATGYHFNVMTCEGCKGFFRRAMKRNARLRCPFRK
GACEITRKTRRQCQACRLRKCLESGMKKEMIMSDEAVEERRALIKRKKSERTGIQPLGVQ
GLTEEQRMMIRELMDAQMKTFDTTFSHFKNFRLPGVLSSGCELPESLQAPSREEAAKWSQ
VRKDLCSLKVSLQLRGEDGSVWNYKPPADNGGKEIFSLLPHMADMSTYMFKGIINFAKVI
SYFRDLPIEDQIALLKGAAFELCQLRFNTVFNAETGTWECGRLSYCLEDTAGGFQQLLLE
PMLKFHYMLKKLQLHEEEYVLMQAISLFSPDRPGVVQHRVVDQLQEKFAITLKSYIECNR
PQPAHRFLFLKIMAMLTELRSINAQHTQRLLRIQDIHPFATPLMQELFGITGS
Download sequence
Identical sequences A0A2I3S3V5
XP_016797208.1.37143 ENSPTRP00000026312 9598.ENSPTRP00000026312 ENSPTRP00000026312

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]