SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000026322 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000026322
Domain Number 1 Region: 46-298
Classification Level Classification E-value
Superfamily L domain-like 1.87e-41
Family Ngr ectodomain-like 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000026322   Gene: ENSPTRG00000015268   Transcript: ENSPTRT00000028521
Sequence length 371
Comment pep:known chromosome:CHIMP2.1.4:3:123701927:123720873:-1 gene:ENSPTRG00000015268 transcript:ENSPTRT00000028521 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEEAGAAVVTAGEAELNWSRLSVSTETLESELEARGEERRGAREALLRLLLPHNRLVSLP
RALGSGFPHLQLLDVSGNALTALGPELLALRGLRTLLAKNNRLGGPSALPKGLAQSPLCR
SLQVLNLSGNCFQEVPASLLELRALQTLSLGGNQLQSIPAEIENLQSLECLYLGGNFIKE
IPPELGNLPSLNYLVLCDNKIQSVPPQLSQLHSLRSLSLHNNLLTYLPREILNLIHLEEL
SLRGNPLVVRFVRDLTYDPPTLLELAARTIKIRNISYTPYDLPGNLLRYLGSASNCPNPK
CGGVYFDCCVRQIKFVDFCGKYRLPLMHYLCSPECSSPCSSASHSSTSQSESDSEDEASV
AARRMQKVLLG
Download sequence
Identical sequences A0A096N8L1 A0A0D9R469 A0A2J8W276 A0A2K5LAR6 A0A2K5W9W3 A0A2K6EAM8 G7MKF1 H2QN62
ENSPANP00000008942 ENSPTRP00000026322 ENSPTRP00000026322 XP_005548106.1.63531 XP_007983863.1.81039 XP_009444519.1.37143 XP_011720482.1.29376 XP_011923838.1.92194 XP_014985450.1.72884

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]