SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000030126 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000030126
Domain Number 1 Region: 317-680
Classification Level Classification E-value
Superfamily SIS domain 6.03e-94
Family double-SIS domain 0.0000015
Further Details:      
 
Domain Number 2 Region: 1-207,248-292
Classification Level Classification E-value
Superfamily N-terminal nucleophile aminohydrolases (Ntn hydrolases) 1.05e-53
Family Class II glutamine amidotransferases 0.0000119
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000030126   Gene: ENSPTRG00000017635   Transcript: ENSPTRT00000032603
Sequence length 680
Comment pep:known_by_projection chromosome:CHIMP2.1.4:5:181478772:181519371:-1 gene:ENSPTRG00000017635 transcript:ENSPTRT00000032603 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GIFAYMNYRVPRTRKEIFETLIKGLQRLEYRGYDSAGVAIDGNNHEVKERHIQLVKKRGK
VKALDEELYKQDSMDLKVEFETHFGIAHTRWATHGVPSAVNSHPQRSDKGNEFVVIHNGI
ITNYKDLRKFLESKGYEFESETDTETIAKLIKYVFDNRETEDITFSTLVERVIQQLEGAF
ALVFKSVHYPGEAVATRRGSPLLIGVRSKYKLSTEQIPILYRTCTLENVKNICKTRMKRL
DSSACLHAVGDKAVEFFFASDASAIIEHTNRVIFLEDDDIAAVADGKLSIHRVKRSASDD
PSRAIQTLQMELQQIMKGNFSAFMQKEIFEQPESVFNTMRGRVNFETNTVLLGGLKDHLK
EIRRCRRLIVIGCGTSYHAAVATRQVLEELTELPVMVELASDFLDRNTPVFRDDVCFFIS
QSGETADTFLALRYCKDRGALTVGVTNTVGSSISRETDCGVHINAGPEIGVASTKAYTSQ
FISLVMFGLMMSEDRISLQNRRQEIIRGLRSLPELIKEVLSLEEKIHDLALELYTRIPPH
GXXXXXCDSDLTSCFQKIKEITYMHSEGILAGELKHGPLALIDKQMPVIMVIMKDPCFAK
CQNALQQVTARQGRPIILCSKDDTESSKFAYKTIELPHTVDCLQGILSVIPLQLLSFHLA
VLRGYDVDFPRNLAKSVTVE
Download sequence
Identical sequences ENSPTRP00000030126 ENSPTRP00000030126

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]