SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000031732 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000031732
Domain Number 1 Region: 2768-2932
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.98e-36
Family Laminin G-like module 0.0000000639
Further Details:      
 
Domain Number 2 Region: 2937-3118
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.77e-34
Family Laminin G-like module 0.0000000333
Further Details:      
 
Domain Number 3 Region: 2336-2523
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 8.06e-31
Family Laminin G-like module 0.0014
Further Details:      
 
Domain Number 4 Region: 2523-2711
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 9.14e-27
Family Laminin G-like module 0.021
Further Details:      
 
Domain Number 5 Region: 2151-2327
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.74e-24
Family Laminin G-like module 0.0014
Further Details:      
 
Domain Number 6 Region: 815-867
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000053
Family Laminin-type module 0.013
Further Details:      
 
Domain Number 7 Region: 865-919
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000837
Family Laminin-type module 0.0025
Further Details:      
 
Domain Number 8 Region: 1420-1471
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000642
Family Laminin-type module 0.018
Further Details:      
 
Domain Number 9 Region: 757-809
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000335
Family Laminin-type module 0.0044
Further Details:      
 
Domain Number 10 Region: 1477-1529
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000368
Family Laminin-type module 0.017
Further Details:      
 
Domain Number 11 Region: 287-346
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000131
Family Laminin-type module 0.034
Further Details:      
 
Domain Number 12 Region: 918-964
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000195
Family Laminin-type module 0.0049
Further Details:      
 
Domain Number 13 Region: 1060-1108
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000109
Family Laminin-type module 0.012
Further Details:      
 
Domain Number 14 Region: 967-1016
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00001
Family Laminin-type module 0.013
Further Details:      
 
Domain Number 15 Region: 414-471
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000176
Family EGF-type module 0.059
Further Details:      
 
Domain Number 16 Region: 344-416
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000212
Family Laminin-type module 0.022
Further Details:      
 
Domain Number 17 Region: 1527-1567
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000335
Family Laminin-type module 0.0088
Further Details:      
 
Domain Number 18 Region: 1014-1057
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000391
Family Laminin-type module 0.012
Further Details:      
 
Domain Number 19 Region: 89-168
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.0000992
Family APC10-like 0.038
Further Details:      
 
Weak hits

Sequence:  ENSPTRP00000031732
Domain Number - Region: 1833-1938
Classification Level Classification E-value
Superfamily ADP-ribosylation 0.000104
Family ADP-ribosylating toxins 0.026
Further Details:      
 
Domain Number - Region: 1120-1163
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000179
Family Laminin-type module 0.018
Further Details:      
 
Domain Number - Region: 1638-1881
Classification Level Classification E-value
Superfamily Methyl-accepting chemotaxis protein (MCP) signaling domain 0.000994
Family Methyl-accepting chemotaxis protein (MCP) signaling domain 0.0041
Further Details:      
 
Domain Number - Region: 1377-1406
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00148
Family Laminin-type module 0.076
Further Details:      
 
Domain Number - Region: 485-520
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00335
Family Laminin-type module 0.016
Further Details:      
 
Domain Number - Region: 722-759
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0165
Family EGF-type module 0.046
Further Details:      
 
Domain Number - Region: 2031-2124
Classification Level Classification E-value
Superfamily Tropomyosin 0.0177
Family Tropomyosin 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000031732   Gene: ENSPTRG00000018588   Transcript: ENSPTRT00000034328
Sequence length 3121
Comment pep:known_by_projection chromosome:CHIMP2.1.4:6:130183228:130818185:1 gene:ENSPTRG00000018588 transcript:ENSPTRT00000034328 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPGAAGVLLLLLLSGGLGGVQAQRPQQQRQSQAHQQRGLFPAVLNLASNALITTNATCGE
KGPEMYCKLVEHVPGQPVRNPQCRICNQNSSNPNQRHPITNAIDGKNTWWQSPSIKNGIE
YHYVTITLDLQQVFQIAYVIVKAANSPRPGNWILERSLDDVEYKPWQYHAVTDTECLTLY
NIYPRTGPPSYAKDDEVICTSFYSKIHPLENGEIHISLINGRPSADDPSPELLEFTSARY
IRLRFQRIRTLNADLMMFAHKDPREIDPIVTRRYYYSVKDISIGGMCICYGHARACPLDP
ATNKSRCECEHNTCGDSCDQCCPGFHQKPWRAGTFLTKTECEACNCHGKAEECYYDENVA
RRNLSLNIRGKYIGGGVCINCTQNTAGINCETCIDGFFRPKGVSPNYPRPCQPCHCDPIG
SLNEVCVKDEKHARRGLAPGSCHCKTGFGGVSCDRCARGYTGYPDCKACNCSGLGSKNED
PCFGPCICKENVEGGDCSRCKSGFFNLQEDNWKGCDECFCSGVSNRCQSSYWTYGKIQDM
SGWYLTDLPGRIRVVPQQDDLDSPQQISISNAEARQVLPHSYYWSAPAPYLGNKLPAVGG
QLTFTISYDLEEEEEDTEHVLQLMIILEGNDLSISTAQDEVYLHPSEEHTNVLLLKEESF
TIHGTHFPVSRKEFMTVLANLKRVLLQITYSFGMDAIFRLSSVNLESAVSYPTDGSIAAA
VEVCQCPPGYTGSSCESCWPRHRRVNGTIFGGICEPCQCFGHAESCDDVTGECLNCKDHT
GGPYCDKCLPGFYGEPTKGTSEDCQPCACPLNIPSNNFSPTCHLDRSLGLICDGCPVGYT
GPRCERCAEGYFGQPSVPGGSCQPCQCNDNLDFSIPGSCDSLSGSCLICKPGTTGRYCEL
CADGYFGDAVDAKNCQPCRCNAGGSFSEVCHSQTGQCECRANVQGQRCDKCKAGTFGLQS
ARGCVPCNCNSFGSKSFDCEESGQCWCQPGVTGKKCDRCAHGYXNFQEGGCTACECSHLG
NNCDPKTGRCICPPNTIGEKCSKCAPNTWGHSITTGCKACNCSTVGSLDFQCNVNTGQCN
CHPKFSGAKCTECNRGHWNYPRCNLCDCFLPGTDAATCDSETEKCSCSDQTGQCTCKVNV
EGIHCDRCRPGKFGLDAKNPLGCSSCYCFGTTTQCSEAKGLIRTWVTLKAEQTILPLVDE
ALQHTTTKGIVFQHPEIVAHMDLMREDLHLEPFYWKLPEQFEGKKLMAYGGKLKYAIYFE
AREETGFSTYNPQVIIRGGTPTHARIIVRHMAAPLIGQLTRHEIEMTEKEWKYYGDDPRV
HRTVTREDFLDILYDIHYILIKATYGNFMRQSRISEISMDVAEQGRRTAVTPPADLIEKC
DCPLGYSGLSCEACLPGFYRLRSQPGGRTPGPTLGTCVPCQCNGHSGLCDPETSICQNCQ
HHTAGDFCERCALGYYGIVKGLPNDCQQCACPLISSSNNFSPSCVAEGLDDYRCTACPRG
YEGQYCERCAPGYTGSPGSPGGSCQECECDPYGSLPVPCDPVTGFCTCRPGATGRKCDGC
KHWHAREGWECVFCGDECTGLLLGDLARLQQMVMSINLTGPLPAPYKLLYGLENMTQELK
HLLSPQRAPERLIQLAEGNLNTLVTEMNELLTRATKVTADGEQTGQDAERTNTRAKSLGE
FIKELARDAEAVNEKAIKLNETLGTRDEAFERNLEGLQKEIDQMIKELRRKNLETQKEIA
EDELVAAEALLKKVKKLFGESRGENEEMEKNLREKLADYKNKVDDAWDLLREATDKIREA
NRLFAVNQKNMTALEKKKEAVESGKRQIENTLKEGNDILDEANRLADEINSIIDYVEDIQ
TKLPPMSEELNDKIDDLSQEIKDRKLAEKVSQAESHAAQLNDSSAVLDGILDEAKNISFN
ATAAFKAYSNIKDYIDEAEKVAKEAKDLAHEATKLATGPRGLLKEDAKGSLQKSFRILNE
AKKLANDVKENEDHLNGLKTRIENADARNGDLLRALNDTLGKLSAIPNDTAAKLQAVKDK
ARQANDTAKDVLAQIKELHQNLDGLKKNYNKLADSVAKTNAVVKDPSKNTVADADATVKN
LEQEADRLIDKLKPIKELEDNLKKNISEIKELINQARKQANSIKVSVSSGGDCIRTYKPE
IKKGSYNNIVVNVKTAVADNLLFYLGSAKFIDFLAIEMRKGKVSFLWDVGSGVGRVEYPD
LTIDDSYWYRIVASRTGRNGTISVRALDGPKASIVPSTHHSTSPPGYTILDVDANAMLFV
GGLTGKLKKADAVRVITFTGCMGETYFDNKPIGLWNFREKEGDCKGCTVSPQVEDSEGTI
QFDGEGYALVSRPIRWYPNISTVMFKFRTFSSSALLMYLATRDLRDFMSVELTDGHIKVS
YDLGSGMASVVSNQNHNDGKWKSFTLSRIQKQANISIVDIDTNQEENIATSSSGNNFGLD
LKADDKIYFGGLPTLRNLSMKARPEVNLKKYSGCLKDIEISRTPYNILSSPDYVGVTKGC
SLENVYTVSFPKPGFVELSPVPVDVGTEINLSFSTKNESGIILLGSGGTPAPPRRKRRQT
GQAYYAILLNRGRLEVHLSTGARTMRKIVIRPEPNLFHDGREHSVHVERTRGIFTVQVDE
NRRYMQNLTVEQPIEVKKLFVGGAPPEFQPSPLRNIPPFEGCIWNLVINSVPMDFARPVS
FKNADIGRCAHQKLREDEDGAAPAEIVIQPEPVPTPAFPTPTPVLTHGPCAAESEPALLI
GSKQFGLSRNSHIAIAFDDTKVKNRLTIELEVRTEAESGLLFYMARINHADFATVQLRNG
LPYFSYDLGSGDTHTMIPTKINDGQWHKIKIMRSKQEGILYVDGASNRTISPKKADILDV
VGMLYVGGLPINYTTRRIGPVTYSIDGCVRNLHMAEAPADLEQPTSSFHVGTCFANAQRG
TYFDGTGFAKAVGEFKVGLDLLVEFEFRTTRTTGVLLGISSQKMDGMGIEMIDEKLMFHV
DNGAGRFTAVYDAGVPGHLCDGQWHKVTANKIKHRIELTVDGNQVEAQSPNPASTSADTN
DPVFVGGFPDDLKQFGLTTSIPFRGCIRSLKLTKGTGKPLEVNFAKALELRGIQPVSCPA
N
Download sequence
Identical sequences ENSPTRP00000031732 ENSPTRP00000031732

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]