SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000033595 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000033595
Domain Number 1 Region: 53-234
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.06e-44
Family Ankyrin repeat 0.00029
Further Details:      
 
Domain Number 2 Region: 275-338
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.0000000143
Family SAM (sterile alpha motif) domain 0.023
Further Details:      
 
Domain Number 3 Region: 245-300,385-421
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.000000196
Family Pseudo ankyrin repeat 0.033
Further Details:      
 
Weak hits

Sequence:  ENSPTRP00000033595
Domain Number - Region: 354-458
Classification Level Classification E-value
Superfamily Bacterial hemolysins 0.0115
Family HBL-like 0.06
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000033595   Gene: ENSPTRG00000019618   Transcript: ENSPTRT00000036337
Sequence length 475
Comment pep:known chromosome:CHIMP2.1.4:7:118849636:118915833:-1 gene:ENSPTRG00000019618 transcript:ENSPTRT00000036337 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAASALRGLPVAGGGESSESEDDGWEIGYLDRTSQKLKGLLPIEEKKEKFKKAMTIGDVS
LVQELLDSGISVDSTFQYGWTPLMYAASVANAELVRVLLDRGANASFEKDKQSILITACS
AHGSEEQILKCVELLLSRNADPNVACRRLMTPIMYAARDGHTQVVALLVAHGAEVNTQDE
NGYTALTWAARQGHKNIVLKLLELGANKMLQTKDGKMPSEIAKRNKHHEIFNLLSFTLNP
LEGKLQQLTKEDTICKILTTDSDREKDHIFSSYTAFGDLEVFLHGLGLEHMTDILKERDI
TLRHLLTMREDEFTKNGITSKDQQKILAALKELQVEEIQFGELSEETKLEISGDEFLNFL
LKLNKQCGHLITAVQNVITELPVNSQKITLEWASPQNFTSVCEELVNNVEDLSEKVCKLK
DLIQKLQNERESDPTHIQLREEVSTWNSRILKRTAITICGFGFLLFICKLTFQRK
Download sequence
Identical sequences A0A2J8QXD8 Q8WMX6
ENSPTRP00000033595 ENSPTRP00000033595 NP_001009035.1.37143 XP_003808696.1.60992 9598.ENSPTRP00000033595

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]