SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000034702 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000034702
Domain Number 1 Region: 42-101
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.51e-17
Family Classic zinc finger, C2H2 0.014
Further Details:      
 
Domain Number 2 Region: 183-233
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000844
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 3 Region: 87-132
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000924
Family Classic zinc finger, C2H2 0.02
Further Details:      
 
Domain Number 4 Region: 120-172
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000441
Family Classic zinc finger, C2H2 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000034702   Gene: ENSPTRG00000020266   Transcript: ENSPTRT00000037547
Sequence length 500
Comment pep:known_by_projection chromosome:CHIMP2.1.4:8:53933765:53987126:-1 gene:ENSPTRG00000020266 transcript:ENSPTRT00000037547 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATVIPGDLSEVRDTQKVPSGKRKRGETKPRKNFPCQLCDKAFNSVEKLKVHSYSHTGER
PYKCIQQDCTKAFVSKYKLQRHMATHSPEKTHKCNYCEKMFHRKDHLKNHLHTHDPNKET
FKCEECGKNYNTKLGFKRHLALHAATSGDLTCKVCLQTFESTGVLLEHLKSHAGKSSGGV
KEKKHQCEHCDRRFYTRKDVRRHMVVHTGRKDFLCQYCAQRFGRKDHLTRHMKKSHNQEL
LKVKTEPVDFLDPFTCNVSVPIKDELLPVMSLPSSELLSKPFTNTLQLNLYNTPFQSMQS
SGSAHQMITTLPLGMTCPIDMDTVHPSHHLSFKYPFSSTSYAISIPEKEQPLKGEIESYL
MELQGGVPSSSQDSQASSSSKLGLDPQIGSLDDGAGDLSLSKSSISISDPLNTPALDFSQ
LFNFIPLNGPPYNPLSVGSLGMSYSQEEAHSSVSQLPPQTQDLQDPANTIGLGSLHSLSA
AFTSSLSTSTTLPRFHQAFQ
Download sequence
Identical sequences A0A024R7Z0 A0A2I3GXL3 A0A2I3TWP5 A0A2J8UNC1 G3SBP9 Q6DJT9
ENSPTRP00000034702 ENSNLEP00000001461 ENSP00000325546 ENSP00000416537 gi|167857794|ref|NP_002646.2| gi|167857796|ref|NP_001108106.1| ENSP00000325546 ENSP00000416537 ENSNLEP00000001461 ENSP00000325546 ENSPTRP00000034702 ENSGGOP00000025526 9598.ENSPTRP00000034702 9606.ENSP00000325546 NP_001108106.1.87134 NP_001108106.1.92137 NP_002646.2.87134 NP_002646.2.92137 XP_003256035.1.23891 XP_003311863.1.37143 XP_003823281.1.60992 XP_003823282.1.60992 XP_008975081.1.60992 XP_012362375.1.23891 XP_016869065.1.92137 XP_018887414.1.27298 XP_018887415.1.27298 XP_519767.2.37143

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]