SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000035287 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000035287
Domain Number 1 Region: 98-180
Classification Level Classification E-value
Superfamily Snake toxin-like 0.0000000458
Family Snake venom toxins 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000035287   Gene: ENSPTRG00000020637   Transcript: ENSPTRT00000038170
Sequence length 223
Comment pep:known_by_projection chromosome:CHIMP2.1.4:8:141504056:141508130:1 gene:ENSPTRG00000020637 transcript:ENSPTRT00000038170 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGLQRPRQAPAGGRRAPRGRRGSPYRPDPGRGARRLRRFQKGGEGASRADPHWASLGTMA
LLALLLVVALPRVWTDANLTARQRDPEDTQQTDEGDNRVWCHVCERENTFECQNPRRCKW
TEPYCVIAAVKIFPRFFVISKQCSAGCAATERPKPEEKWFLLEEPMPFFYLKCCKIRYCN
LEGPPINSSVFKEYAGSMGESCGGLWMAILLLLASIAAGLSLS
Download sequence
Identical sequences ENSPTRP00000035287 ENSPTRP00000035287 XP_519990.2.37143 9598.ENSPTRP00000035287

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]