SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000035965 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000035965
Domain Number 1 Region: 33-59,175-353
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 6.24e-57
Family G proteins 0.0000000595
Further Details:      
 
Domain Number 2 Region: 63-182
Classification Level Classification E-value
Superfamily Transducin (alpha subunit), insertion domain 3.66e-43
Family Transducin (alpha subunit), insertion domain 0.00000239
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000035965   Gene: ENSPTRG00000021042   Transcript: ENSPTRT00000038912
Sequence length 355
Comment pep:known chromosome:CHIMP2.1.4:9:76031708:76262792:-1 gene:ENSPTRG00000021042 transcript:ENSPTRT00000038912 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGCCCLSAEEKESQRISAEIERQLRRDKKDARRELKLLLLGTGESGKSTFIKQMRIIHG
SGYSDEDRKGFTKLVYQNIFTAMQAMIRAMDTLRIQYVCEQNKENAQIIREVEVDKVSML
SREQVEAIKQLWQDPGIQECYDRRREYQLSDSAKYYLTDIDRIATPSFVPTQQDVLRVRV
PTTGIIEYPFDLENIIFRMVDVGGQRSERRKWIHCFESVTSIIFLVALSEYDQVLAECDN
ENRMEESKALFKTIITYPWFLNSSVILFLNKKDLLEEKIMYSHLISYFPEYTGPKQDVKA
ARDFILKLYQDQNPDKEKVIYSHFTCATDTDNIRFVFAAVKDTILQLNLREFNLV
Download sequence
Identical sequences A0A2I3TRC4 A0A2K6KC16 A0A2K6QD59 G3RCJ5 H2PSG3
9598.ENSPTRP00000035965 9600.ENSPPYP00000021632 ENSPPYP00000021632 ENSGGOP00000013227 XP_003811503.1.60992 XP_010362759.1.97406 XP_017748259.1.44346 XP_528331.2.37143 ENSPTRP00000035965 ENSPPYP00000021632 ENSGGOP00000013227 ENSPTRP00000035965

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]