SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000036398 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000036398
Domain Number 1 Region: 58-191,367-589
Classification Level Classification E-value
Superfamily RNI-like 4.24e-39
Family Cyclin A/CDK2-associated p19, Skp2 0.056
Further Details:      
 
Domain Number 2 Region: 670-816
Classification Level Classification E-value
Superfamily Toll/Interleukin receptor TIR domain 3.01e-37
Family Toll/Interleukin receptor TIR domain 0.0000487
Further Details:      
 
Domain Number 3 Region: 296-386
Classification Level Classification E-value
Superfamily Outer arm dynein light chain 1 0.000000484
Family Outer arm dynein light chain 1 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000036398   Gene: ENSPTRG00000021299   Transcript: ENSPTRT00000039393
Sequence length 839
Comment pep:known chromosome:CHIMP2.1.4:9:116679131:116689761:1 gene:ENSPTRG00000021299 transcript:ENSPTRT00000039393 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMSASRLAGTLIPAMAFLSCVRPESWEPCVEVVPNITYQCMELNFYKIPDNLPFSTKNLD
LSFNPLRHLGSYSFFSFPELQVLDLSRCEIQTIEDGAYQSLSHLSTLILTGNPIQSLALG
AFSGLSSLQKLVAVETNLASLENFPIGHLKTLKELNVAHNLIQSFKLPEYFSNLTNLEHL
DLSSNKIQSIYCTDLRVLHQMPLLNLSLDLSLNPMNFIQPGAFKEIRLHKLTLRNNFDSL
NVMKTCIQGLAGLEVHRLVLGEFRNEGNLEKFDKSALEGLCNLTMEEFRLAYLDYYLDDI
IDLFNCLTNVSSFSLVSVTIKSVKDFSYNFGWQHLELVNCKFGQFPTLKLKSLKRLTFTS
NKGGNAFSEVDLPSLEFLDLSRNGLSFKGCCSQSDFGTTSLKYLDLSFNGVITMSSNFLG
LEQLEHLDFQHSNLKQMSEFSVFLSLRNLIYLDISHTHTRVAFNGIFNGLSSLEVLKMAG
NSFQENFLPDIFTELRNLTFLDLSQCQLEQLSPTAFNSLSSLQVLNMSHNNFFSLDTFPY
KCLNSLQVLDYSLNHIMTSKKQELQHFPSSLAFLNLTQNDFACTCEHQSFLQWIKDQRQL
LVEVERMECATPSDKQGMPVLSLNITCQMNKTIIGVSVLSVLVVSVVAVLVYKFYFHLML
LAGCIKYGRGENIYDAFVIYSSQDEDWVRNELVKNLEEGVPPFQLCLHYRDFIPGVAIAA
NIIHEGFHKSRKVIVVVSQHFIQSRWCIFEYEIAQTWQFLSSRAGIIFIVLQKVEKTLLR
RQVELYRLLSRNTYLEWEDSVLGRHIFWRRLRKALLDGKSWNPEGTVGTGCNWQEATSI
Download sequence
Identical sequences ENSPTRP00000036398 ENSPTRP00000036398 9598.ENSPTRP00000036398

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]