SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000040803 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000040803
Domain Number 1 Region: 244-287
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000227
Family Classic zinc finger, C2H2 0.0065
Further Details:      
 
Domain Number 2 Region: 180-234
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000394
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 3 Region: 273-315
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000029
Family Classic zinc finger, C2H2 0.013
Further Details:      
 
Domain Number 4 Region: 136-181
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000109
Family Classic zinc finger, C2H2 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000040803   Gene: ENSPTRG00000022932   Transcript: ENSPTRT00000042692
Sequence length 753
Comment pep:known chromosome:CHIMP2.1.4:1:38044922:38097477:-1 gene:ENSPTRG00000022932 transcript:ENSPTRT00000042692 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGEHSPDNNIIYFEAEEDELTPDDKMLRFVDKNGLVPSSSGTVYDRTTVLIEQDPGTLED
EDDDGQCGEHLPFLVGGEEGFHLIDHEAMSQGYVQHIISPDQIHLTINPGSTPMPRNIEG
ATLTLQSECPETKRKEVKRYQCTFEGCPRTYSTAGNLRTHQKTHRGEYTFVCNQEGCGKA
FLTSYSLRIHVRVHTKEKPFECDVQGCEKAFNTLYRLKAHQRLHTGKTFNCESEGCSKYF
TTLSDLRKHIRTHTGEKPFRCDHDGCGKAFAASHHLKTHVRTHTGERPFFCPSNGCEKTF
STQYSLKSHMKGHDNKGHSYNALPQHNGSEDTNHSLCLSDLSLLSTDSELRENSSTTQGQ
DLSTISPAIIFESMFQNSDDTAIQEDPQQTASLIESFNGDAESVSDVPPSTGNSASLSLP
LVLQPGLSEPPQPLLPASAPSAPPPAPSLGPGSQQAAFGNPPALLQPPEVPVPHSTQFAA
NHQEFLPHPQAPQPIVPGLSVVAGASASAAAVASAVAAPAPPQSTTEPLPAMVQTLPLGA
NSVLTNNPTITITPTPNTAILQSSLVMGEQNLQWILNGATSSPQNQEQIQQASKVEKVFF
TTAVPVASSPGSSVQQIGLSVPVIIIKQEEACQCQCACRDSAKERASSRRKGCSSPPPPE
PSPQAPDGPSLQLPAQTFSSAPVPGSSSSTMPSSCEQSRQAETPSDPQTETLSAMDVSEF
LSLQSLDTPSNLIPIEALLQGEEEMGLTSSFSK
Download sequence
Identical sequences H2R0J1
9598.ENSPTRP00000040803 XP_003815530.1.60992 XP_009451322.1.37143 XP_016806813.1.37143 XP_016806861.1.37143 ENSPTRP00000040803 ENSPTRP00000040803

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]