SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000041381 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000041381
Domain Number 1 Region: 315-372
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.17e-25
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Domain Number 2 Region: 69-130
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 7.98e-25
Family KRAB domain (Kruppel-associated box) 0.0013
Further Details:      
 
Domain Number 3 Region: 427-484
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.79e-24
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 
Domain Number 4 Region: 371-428
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.82e-21
Family Classic zinc finger, C2H2 0.013
Further Details:      
 
Domain Number 5 Region: 469-521
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.07e-19
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 6 Region: 277-329
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.38e-19
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Weak hits

Sequence:  ENSPTRP00000041381
Domain Number - Region: 2-39
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 0.000325
Family SCAN domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000041381   Gene: ENSPTRG00000000590   Transcript: ENSPTRT00000044635
Sequence length 534
Comment pep:known_by_projection chromosome:CHIMP2.1.4:1:40746136:40759203:1 gene:ENSPTRG00000000590 transcript:ENSPTRT00000044635 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLQQLLITLPTEASTWVKLRHPKAATERVALWEDVTKMFKAEALLSQDADETQGESLESR
VTLGSLTAESQELLTFKDVSVDFTQEEWGQLAPAHRNLYREVMLENYGNLVSVGCQLSKP
GVISQLEKGEEPWLMERDISGVPSSDLKSKTKTKESALQNDISWEELHCGLMMERFTKGS
TMYSTLGRISKCNKLESQQENQRMGERQIPLMCKKTFTQERGQESNRFEKRINVKSEVMP
GPIVLPRKRDRKYDTLEKRSRYNIDLVNHSRSYTKMKTFECNICEKIFKQLIHLTEHMRI
HTGEKPFRCKECGKAFSQSSSLIPHQRIHTGEKPYECKECGKTFRHPSSLTQHVRIHTGE
KPYECRVCEKAFSQSIGLIQHLRTHVREKPFTCKDCGKAFFQIRHLRQHEIIHTGVKPYI
CNVCSKTFSHSTYLTQHQRTHTGERPYKCKECGKAFSQRIHLSIHQRVHTGVKPYECSHC
GKAFRHDSSFAKHQRIHTGEKPYDCNECGKAFSCSSSLIRHCKTHLRNTFSNVV
Download sequence
Identical sequences H2R0W8
ENSPTRP00000041381 ENSPTRP00000041381 XP_513356.2.37143

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]