SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000042045 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000042045
Domain Number 1 Region: 25-187
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.03e-18
Family SPRY domain 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000042045   Gene: ENSPTRG00000005879   Transcript: ENSPTRT00000044065
Sequence length 196
Comment pep:known_by_projection chromosome:CHIMP2.1.4:13:49634579:49656426:-1 gene:ENSPTRG00000005879 transcript:ENSPTRT00000044065 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATSVLCCLRCCRDGGTGHIPLKEMPAVQLDTQHMGTDVVIVKNGRRICGTGGCLASAPL
HQNKSYFEFKIQSTGIWGIGVATQKVNLNQIPLGRDVHSLVMRNDGALYHNNEEKNRLPA
NSLPQEGDVVGITYDHVELNVYLNGKNMHCPASGIRGTVYPVVYVDDSAILDCQFSEFYH
TPPPGFEKILFEQQIF
Download sequence
Identical sequences G1QUC7 G3SIB6 H2R1A5
XP_003809860.1.60992 XP_012362308.1.23891 XP_018895275.1.27298 XP_018895277.1.27298 XP_522757.2.37143 ENSNLEP00000004547 ENSPTRP00000042045 ENSPTRP00000042045 9598.ENSPTRP00000042045 ENSNLEP00000004547

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]