SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000042959 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000042959
Domain Number 1 Region: 5-358
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 6.02e-130
Family Motor proteins 0.0000000000557
Further Details:      
 
Domain Number 2 Region: 497-598
Classification Level Classification E-value
Superfamily SMAD/FHA domain 2.1e-29
Family FHA domain 0.0000012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000042959   Gene: ENSPTRG00000008620   Transcript: ENSPTRT00000048539
Sequence length 1102
Comment pep:known chromosome:CHIMP2.1.4:17:5026564:5054805:1 gene:ENSPTRG00000008620 transcript:ENSPTRT00000048539 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGASVKVAVRVRPFNARETSQDAKCVVSMQGNTTSIINPKQSKDAPKSFTFDYSYWSHT
SMEDPQFASQQQVYRDIGEEMLLHAFEGYNVCIFAYGQTGAGKSYTMMGRQEPGQQGIVP
QLCEDLFSRVSENQSAQLSYSVEVSYMEIYCERVRDLLNPKSRGSLRVREHPILGPYVQD
LSKLAVTSYADIADLMDCGNKARTVAATNMNETSSRSHAVFTIVFTQRCHDQLTGLDSEK
VSKISLVDLAGSERADSSGARGMRLKEGANINKSLTTLGKVISALADMQSKKRKSDFIPY
RDSVLTWLLKENLGGNSRTAMIAALSPADINYEETLSTLRYADRTKQIRCNAIINEDPNA
RLIRELQEEVARLRELLMAQGLSASALEGLTEEGSVRGALPAVSSPPAPVSPSSPTTHNG
ELEPSFSPNTEPQIGPEEAMERLQETEKIIAELNETWEEKLRKTEALRMEREALLAEMGV
AVREDGGTVGVFSPKKTPHLVNLNEDPLMSECLLYHIKDGVTRVGQVDMDIKLTGQFIRE
QHCLFRSIPQPDGEVVVTLEPCEGAETYVNGKLVTEPLVLKSGNRIVMGKNHVFRFNHPE
QARLERERGVPPPPGPPSEPVDWNFAQKELLEQQGIDIKLEMEKRLQDLENQYRKEKEEA
DLLLEQQRLYADSDSGDDSDKRSCEESWRLISSLREQLPPTTVQTIVKRCGLPSSGKRRA
PRRVYQIPQRRRLQGKDPRWATMADLKMQAVKEICYEVALADFRHGRAEIEALAALKMRE
LCRTYGKPEGPGDAWRAVARDVWDTVGEEEGGGAGSGGGSEEGARGAEVEDLRAHIDKLT
GILQEVKLQNSSKDRELQALRDRMLRMERVIPLAQDHEDENEEGGEVPWAPPEGSEAAEE
AAPSDHMPSARPPSPPLSSWERVSRLMEEDPAFRRGRLRWLKQEQLRLQGLQGSGGRGGG
LRRPPARFVPPHDCKLRFPFKSNPQHRESWPGMGSGEAPTPPQPPEEVTPHPATPARRPP
SPRRSHHPRRNSLDGGGRSRGAGSAQPEPQHFQPKKHNSYPQPPQPYPAQRPPGPRYPPY
TTPPRMRRQRSAPDLKESGAAV
Download sequence
Identical sequences 9598.ENSPTRP00000042959 ENSPTRP00000042959 ENSPTRP00000042959

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]