SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000043380 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000043380
Domain Number 1 Region: 510-769
Classification Level Classification E-value
Superfamily NHL repeat 2.88e-43
Family NHL repeat 0.0000146
Further Details:      
 
Domain Number 2 Region: 360-456
Classification Level Classification E-value
Superfamily E set domains 1.67e-22
Family Filamin repeat (rod domain) 0.0033
Further Details:      
 
Domain Number 3 Region: 136-198
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.00000000000000183
Family B-box zinc-binding domain 0.002
Further Details:      
 
Domain Number 4 Region: 45-119
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000000000442
Family RING finger domain, C3HC4 0.0079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000043380   Gene: ENSPTRG00000016522   Transcript: ENSPTRT00000045787
Sequence length 771
Comment pep:known_by_projection chromosome:CHIMP2.1.4:4:156247118:156382254:1 gene:ENSPTRG00000016522 transcript:ENSPTRT00000045787 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHRSGRYGTQQQRAGSKTAGPPCQWSRMASEGTNIPSPVVRQIDKQFLICSICLERYKNP
KVLPCLHTFCERCLQNYIPAHSLTLSCPVCRQTSILPEKGVAALQNNFFITNLMDVLQRT
PGSNVEESSILETVTAVAAGKPLSCPNHDGNVMEFYCQSCETAMCRECTEGEHAEHPTVP
LKDVVEQHKASLQVQLDAVNKRLPEIDSALQFISEIIHQLTNQKASIVDDIHSTFDELQK
TLNVRKSVLLMELEVNYGLKHKVLQSQLDTLLQGQESIKSCSNFTAQALNHGTETEVLLV
KKQMSEKLNELADQDFPLHPRENDQLDFIVETEGLKKSIHNLGTILTTNAVASETVATGE
GLRQTIIGQPMSVTITTKDKDGELCKTGNAYLTAELSTPDGSVADGEILDNKNGTYEFLY
TVQKEGDFTLSLRLYDQHIRGSPFKLKVIRSADVSPTTEGVKRRVKSPGSGHVKQKAVKR
PASMYSTGKRKENPIEDDLIFRVGTKGRNKGEFTNLQGVAASTNGKILIADSNNQCVQCK
EKSLXXXXRFGIRGRSPGQLQPFTGVAVHPSGDIIIADYDNKWVSIFSSDGKFKTKIGSG
KLMGPKGVSVDRNGHIIVVDNKACCVFIFQPNGKIVTRFGSRGNGDRQFAGPHFAAVNSN
NEIIITDFHNHSVKVFNQEGEFMLKFGSNGEGNGQFNAPTGVAVDSNGNIIVADWGNSRI
QVFDGSGSFLSYINTSADPLYGPQGLALTSDGHVVVADSGNHCFKVYRYLQ
Download sequence
Identical sequences ENSPTRP00000043380 ENSPTRP00000043380

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]