SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000044185 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000044185
Domain Number 1 Region: 5-92
Classification Level Classification E-value
Superfamily EF-hand 7.35e-18
Family S100 proteins 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000044185   Gene: ENSPTRG00000023848   Transcript: ENSPTRT00000044773
Sequence length 103
Comment pep:novel chromosome:CHIMP2.1.4:1:131852382:131854024:-1 gene:ENSPTRG00000023848 transcript:ENSPTRT00000044773 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSDCYTELEKAVIVLVENFYKYVSKYSLVKNKISKSSFREMLQKELNHMLSDTGNRKAAD
KLIQNLDANHDGRISFDEYWTLIGGITGPIAKLIREQEQQSSS
Download sequence
Identical sequences A0A2I3LYF0 A0A2J8VFL8 A0A2K5HEU9 A0A2K5NZS7 A0A2K6AI51 A0A2K6D357 A0A2K6JVJ8 A0A2K6Q947 G1RHH0 G3S962 G7NUG9 H2R2M4 H9Z3V3
ENSGGOP00000024627 ENSNLEP00000012670 ENSPTRP00000044185 ENSPANP00000007108 9598.ENSPTRP00000044185 9600.ENSPPYP00000000943 XP_003259369.1.23891 XP_003259370.1.23891 XP_003308544.1.37143 XP_003817211.1.60992 XP_004026804.1.27298 XP_005541827.1.63531 XP_005541828.1.63531 XP_007975262.1.81039 XP_007975263.1.81039 XP_008968598.1.60992 XP_009430522.1.37143 XP_010363076.1.97406 XP_010363077.1.97406 XP_011767782.1.29376 XP_011767783.1.29376 XP_011783540.1.43180 XP_011783542.1.43180 XP_011823596.1.47321 XP_011823597.1.47321 XP_011823598.1.47321 XP_011931983.1.92194 XP_011931985.1.92194 XP_015008504.1.72884 XP_015008513.1.72884 XP_015312482.1.63531 XP_017712964.1.44346 XP_018878423.1.27298 ENSPTRP00000044185 ENSGGOP00000024627

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]