SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000047545 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000047545
Domain Number 1 Region: 69-162
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.34e-21
Family Ubiquitin-related 0.00000723
Further Details:      
 
Domain Number 2 Region: 452-528
Classification Level Classification E-value
Superfamily UBA-like 9.93e-20
Family UBA domain 0.0000979
Further Details:      
 
Domain Number 3 Region: 350-417
Classification Level Classification E-value
Superfamily UBA-like 0.00000000016
Family UBA domain 0.013
Further Details:      
 
Domain Number 4 Region: 236-389
Classification Level Classification E-value
Superfamily TPR-like 0.00000548
Family Tetratricopeptide repeat (TPR) 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000047545   Gene: ENSPTRG00000019883   Transcript: ENSPTRT00000036838
Sequence length 601
Comment pep:known_by_projection chromosome:CHIMP2.1.4:7:152500929:152537581:1 gene:ENSPTRG00000019883 transcript:ENSPTRT00000036838 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAQKKYLQAKLTQFLREDRIQLWKPPYTDENKKVGLALKDLAKQYSDRLECCENEVEKVI
EEIRCKAIERGTGNDNYRTTGIATIEVFLPPRLKKDRKNLLETRLHITGRELRSKIAETF
GLQENYIKIVINKKQLQLGKTLEEQGVAHNVKAMVLELKQSEEDARKNFQLEEEEQNEAK
LKEKQIQRTKRGLEILAKRAAETVVDPEMTPYLDIANQTGRSIRIPPSERKALMLAMGYH
EKGRAFLKRKEYGIALPCLLDADKYFCECCRELLDTVDNYAVLQLDIVWCYFRLEQLECL
DDAEKKLNLAQKCFKNCYGENHQRLVHIKGNCGKEKVLFLRLYLLQGIRNYHSGNDVEAC
EYLNKARQLFKELYIDPSKVDNLLQLGFTAQEARLGLRACDGNVDHAATHITNRREELAQ
IRKEEKEKKRRRLENIRFLKGMGYSTHAAQQILLSNPQMWWLNDSNPETDNRQESPSQEN
IDQLVYMGFDALVAEAALRVFRGNVQLAAQTLAHNGGSLPPELPLSPEDSLSPPATSPSD
SAGTSSASTDEDMETEAVNEILEDIPEHEEDYLDSTLEDEEIIIAEYLSYVENRKSATKK
N
Download sequence
Identical sequences ENSPTRP00000047545 ENSPTRP00000047545

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]