SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000047790 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000047790
Domain Number 1 Region: 387-436
Classification Level Classification E-value
Superfamily UBA-like 1.17e-17
Family UBA domain 0.00012
Further Details:      
 
Domain Number 2 Region: 112-173
Classification Level Classification E-value
Superfamily RING/U-box 9.18e-17
Family ZZ domain 0.011
Further Details:      
 
Domain Number 3 Region: 44-97
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.0000000000308
Family PB1 domain 0.0084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000047790   Gene: ENSPTRG00000017626   Transcript: ENSPTRT00000055318
Sequence length 440
Comment pep:known chromosome:CHIMP2.1.4:5:180967547:180983436:1 gene:ENSPTRG00000017626 transcript:ENSPTRT00000055318 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASLTVKAYLLGKEDAAREIRRFSFCFSPEPEAEAEAAAGPGPCERLLSRVAALFPALRP
GGFQAHYRDEDGDLVAFSSDEELTMAMSYVKDDIFRIYIKEKKECRRDHRPPCAQEAPRN
MVHPNVICDGCNGPVVGTRYKCSVCPDYDLCSVCEGKGLHRGHTKLAFPSPFGHLSEGFS
HSRWLRKVKHGHFGWPGWEMGPPGNWSPRPPRAGEARPGPTAESASGPSEDPSVNFLKNV
GESVAAALSPLGIEVDIDVEHGGKRSRLTPVSPESSSTEEKSSSQPSSCCSDPSKPGGNV
EGATQSLAEQMRKIALESEGRPEEQMESDNCSGGDDDWTHLSSKEVDPSTGELQSLQMPE
SEGPSSLDPSQEGPTGLKEAALYPHLPPEADPRLIESLSQMLSMGFSDEGGWLTRLLQTK
NYDIGAALDTIQYSKHPPPL
Download sequence
Identical sequences H2R540
ENSPTRP00000047790 ENSPTRP00000047790 9598.ENSPTRP00000047790 XP_001153075.1.37143 XP_003809255.1.60992

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]