SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000047873 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000047873
Domain Number 1 Region: 17-389
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 7.73e-103
Family Choline kinase 0.000000297
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000047873   Gene: ENSPTRG00000003980   Transcript: ENSPTRT00000007426
Sequence length 391
Comment pep:known chromosome:CHIMP2.1.4:11:65736916:65806208:-1 gene:ENSPTRG00000003980 transcript:ENSPTRT00000007426 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LPLPQSPPPQPPADEQPEPRTRRRAYLWCKEFLPGAWRGLREDEFHISVIRGGLSNMLFQ
CSLPDTTATLGDEPRKVLLRLYGAILQMRSCNKEGSEQAQKENEFQGAEAMVLESVMFAI
LAERSLGPKLYGIFPQGRLEQFIPSRRLDTEELSLPDISAEIAEKMATFHGMKMPFNKEP
KWLFGTMEKYLKEVLRIKFTEESRIKKLHKLLSYNLPLELENLRSLLESTPSPVVFCHND
CQEGNILLLEGRENSEKQKLMLIDFEYSSYNYRGFDIGNHFCEWMYDYSYEKYPFFRANI
RKYPTKKQQLHFISSYLPAFQNDFENLSTEEKSIIKEEMLLEVNRFALASHFLWGLWSIV
QAKISSIEFGYMDYAQARFDAYFHQKRKLGV
Download sequence
Identical sequences ENSPTRP00000047873 ENSPTRP00000047873

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]