SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000048024 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000048024
Domain Number 1 Region: 501-742
Classification Level Classification E-value
Superfamily vWA-like 5.06e-77
Family Trunk domain of Sec23/24 0.00000555
Further Details:      
 
Domain Number 2 Region: 695-835
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 3.14e-39
Family beta-sandwich domain of Sec23/24 0.00073
Further Details:      
 
Domain Number 3 Region: 944-1092
Classification Level Classification E-value
Superfamily C-terminal, gelsolin-like domain of Sec23/24 2.25e-35
Family C-terminal, gelsolin-like domain of Sec23/24 0.0009
Further Details:      
 
Domain Number 4 Region: 274-467
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 4.97e-29
Family beta-sandwich domain of Sec23/24 0.0019
Further Details:      
 
Domain Number 5 Region: 839-940
Classification Level Classification E-value
Superfamily Helical domain of Sec23/24 8.37e-26
Family Helical domain of Sec23/24 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000048024   Gene: ENSPTRG00000017246   Transcript: ENSPTRT00000031930
Sequence length 1093
Comment pep:known chromosome:CHIMP2.1.4:5:135329545:135411318:1 gene:ENSPTRG00000017246 transcript:ENSPTRT00000031930 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSQPGIPASGGAPASLQAQNGAALASGSPYTNGPVQNALLSSQESVSQGHNFQLPGSYPH
PIPAKTLNPVSGQSNYGGSQGSGQTLNRPPVASNPVTPLLHSGPAPRMPLPASQNPSTTP
MPSSSFLPEANLPPPLNWQYNYPSTASQTNHCPRASSQPTVSGNTSLTTNHQYVSSGYPS
LQDSFIKSGPSVPPLVNPPLPTTFQPGAPHGPPPAGGPPPVRALTPLTSSYRDVPQPLFN
SAVNQEGITSNTNNGSMVVHSSYDEIEGGGLLATPQLTNKNPKMSRSVGYSYPSLPPGYQ
NTTPPGATGVSPSSLNYPSGPQAFTQTPLGANHLTTSMSGLSLQPEGLRVVNLLQERNML
PSTPLKPPVPNLHEDIQKLNCNPELFRCTLTSIPQTQALLNKAKLPLGLLLHPFKDLVQL
PVVTSSTIVRCRSCRTYINPFVSFLDQRRWKCNLCYRVNDVPEEFLYNPLTRVYGEPHRR
PEVQNATIEFMAPSEYMLRPPQPPVYLFVFDVSHNAVETGYLNSVCQSLLDNLDLLPGNT
RTKIGFITFDSTIHFYGLQESLSQPQMLIVSDIEDVFIPMPENLLVNLNESKELVQDLLK
TLPQMFTKTLETQSALGPALQAAFKLMSPTGGRMSVFQTQLPTLGVGALKPREEPNHRSS
AKDIHMTPSTDFYKKLALDCSGQQVAVDLFLLSGQYSDLASLGCISRYSAGSVYYYPSYH
HQHNPVQVQKLQKELQRYLTRKIGFEAVMRIRCTKGLSIHTFHGNFFVRSTDLLSLPNVS
PDAGYAVQMSVEESLTDTQLVSFQSALLYTSSKGERRIRVHTLCLPVVSTLNDVFLGADV
QAISGLLANMAVDRSMTASLSDARDALVNAVIDSLSAYRSSVLSNQQPGLMVPFSLRLFP
LFVLALLKQKSFQTGTNARLDERIFAMCQVKNQPLVYLMLTTHPSLYRVDNLSDEGALNI
SDRTIPQPPILQLSVEKLSRDGAFLMDAGSVLMLWVGKNCTQNFLSQVLGVQNYASIPQP
MTDLPELDTPESARIIAFISWLREQRPFFPILYVIRDESPMKANFLQNMIEDRTESALSY
YEFLLHIQQQVNK
Download sequence
Identical sequences H2R5C3
ENSPTRP00000048024 XP_527165.2.37143 9598.ENSPTRP00000048024 ENSPTRP00000048024

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]