SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000048088 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000048088
Domain Number 1 Region: 26-197
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.94e-45
Family SPRY domain 0.00027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000048088   Gene: ENSPTRG00000024137   Transcript: ENSPTRT00000006766
Sequence length 199
Comment pep:novel chromosome:CHIMP2.1.4:11:87770286:87771978:1 gene:ENSPTRG00000024137 transcript:ENSPTRT00000006766 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RYESLLLQVSEPVNPELSAGPITGLLDRLSGFRVDFTLQPERTNSHIFLYGDLRSMNVGC
DPQDDPDITAKSECFLEWGAQAFTSGKYYWEVHVGDSWNWAFGVCNNYWKEKRQNDKIDG
EEGLFLLGCVKEDTHCSLFTTSPLVVQYVPRPTSTVGLFLDCESRTMSFVDVDQSSLIYT
IPNCSFSPPLRPIFCCSHF
Download sequence
Identical sequences ENSPTRP00000048088 ENSPTRP00000048088

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]