SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000048463 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000048463
Domain Number 1 Region: 277-334
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.43e-22
Family Classic zinc finger, C2H2 0.0054
Further Details:      
 
Domain Number 2 Region: 9-68
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 5.23e-21
Family KRAB domain (Kruppel-associated box) 0.0017
Further Details:      
 
Domain Number 3 Region: 319-371
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.45e-19
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 
Domain Number 4 Region: 222-278
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000515
Family Classic zinc finger, C2H2 0.0093
Further Details:      
 
Domain Number 5 Region: 88-147
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000344
Family Classic zinc finger, C2H2 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000048463   Gene: ENSPTRG00000028867   Transcript: ENSPTRT00000055880
Sequence length 401
Comment pep:known_by_projection chromosome:CHIMP2.1.4:19:62871891:62895411:1 gene:ENSPTRG00000028867 transcript:ENSPTRT00000055880 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAAAPRRPTQGTVTFEDVAVKFTQEEWNLLSEAQRCLYRDVTLENLALMSSLGCWCGVE
DEAAPSKQSIYIQRETQVRTPMTGVSPKKAHPCEMCGPILGDILHVADHQGTHHKQKLHR
CEAWGNKLYDSGNFHQHQNEHIGEKPYRESVEEALFAKRCKLHVSGESSVFSENGKDFLP
RSGLLQQEASHTGEKSNSKTECVSPIQCGGAHYSHGDSMKHFSTKHILSQHQRLLPREEC
YVCCECGKSFSKYVSFSNHQRVHTVKRPYECGECGKSFSHQSSFSNHQRVHTGEKPYGCE
ECGKYFSLEGHLRRHQKVHAGKGPYECGECGKSFSSNVNLKSHQRIHTGERPYKCGECEK
SFSRKPSLSYHQRFRRLRWVDHKDRKEFKTSLGNIVKSRLF
Download sequence
Identical sequences ENSPTRP00000048463

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]