SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000049386 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000049386
Domain Number 1 Region: 19-91
Classification Level Classification E-value
Superfamily Conserved domain common to transcription factors TFIIS, elongin A, CRSP70 0.00000000000000123
Family Conserved domain common to transcription factors TFIIS, elongin A, CRSP70 0.0043
Further Details:      
 
Weak hits

Sequence:  ENSPTRP00000049386
Domain Number - Region: 284-315
Classification Level Classification E-value
Superfamily F-box domain 0.0281
Family F-box domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000049386   Gene: ENSPTRG00000041809   Transcript: ENSPTRT00000056626
Sequence length 440
Comment pep:novel chromosome:CHIMP2.1.4:18:42929613:42931411:-1 gene:ENSPTRG00000041809 transcript:ENSPTRT00000056626 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAGSTTLPAVEKLQVRLATKTDPKKLEKYLQKLSALPMTADILAETGIRKTVKRLRKHQ
HVGDFARDLAARWKKLVLVDRNPGPDPQDPEESASRQRFGEALQDRGKAWGFPENATAPR
SPSHSPEHRRTARTTPPGQQRPHPRSPSREPRAERKRPRMAPADSGPHPSEAWMQANYDL
LSAFEAMTSQANPEALSAPTLQEEAAFPGRRVNAKMPVYSGSRPACQLQVPTLRQQCLRV
PRNNPDALGDVEGVPYSVLEPVLEGWTPDQLYRTEKDNPALARETDELWRIHCLRDFKEE
KPQEHESWRELYLRLRDAREQRLRVVTTKIRSARENKPSGRQTKMICFNSVAKTPYDASR
RQEESAGAADPRNGDIEPAPKPAGSSQAPSGLGDGDGGSISGGSSNQHAAPADKTRKQAA
KKVAPLMARIRDYRGRFSRR
Download sequence
Identical sequences ENSPTRP00000049386 ENSPTRP00000049386

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]