SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000050242 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000050242
Domain Number 1 Region: 205-264
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.5e-19
Family Classic zinc finger, C2H2 0.0098
Further Details:      
 
Domain Number 2 Region: 265-326
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.69e-19
Family Classic zinc finger, C2H2 0.013
Further Details:      
 
Domain Number 3 Region: 309-363
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000865
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 4 Region: 165-219
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000139
Family Classic zinc finger, C2H2 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000050242   Gene: ENSPTRG00000018080   Transcript: ENSPTRT00000057374
Sequence length 570
Comment pep:known chromosome:CHIMP2.1.4:6:35702991:35739953:1 gene:ENSPTRG00000018080 transcript:ENSPTRT00000057374 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MESLGLHTVTLSDGTTAYVQQAVKGEKLLEGQVIQLEDGTTAYIHQVTVQKEALSFEDGQ
PVQLEDGSMAYIHRTPREGYDPSTLEAVQLEDGSTAYIHHPVAVPSDSTILAVQTEVGLE
DLAAEDDEGFSADTVVALEQYASKVLHDSQIPHNGKGQQVGDRAFRCGYKGCGRLYTTAH
HLKVHERAHTGDRPYRCDFPSCGKAFATGYGLKSHVRTHTGEKPYKCPEELCSKAFKTSG
DLQKHVRTHTGERPFRCPFEGCGRSFTTSNIRKVHVRTHTGERPYTCPEPHCGRGFTSAT
NYKNHVRIHTGEKPYVCTVPGCGKRFTEYSSLYKHHVVHTHCKPYTCSTCGKTYRQTSTL
AMHKRSAHGELEATEESEQALYEQQQLEAASAAEESPPPKRPRIAYLSEVKEESDDIPAQ
VAMVTEEDGAPQVALITQDGAQQVSLSPEDLQALGSAISMVTQHGSTTLTIPSPDADLAT
SGTHTVTMVSADGTQTQPVTIITSGAVVAEDSSVASLRHQQVALLATANGTHIAVQLEEQ
QTLEEAISVATAAMQQGAVTLETTVSESGC
Download sequence
Identical sequences H2R7D7
ENSPTRP00000050242 XP_003808578.1.60992 XP_008958844.1.60992 XP_016810787.1.37143 XP_016810788.1.37143 ENSPTRP00000050242 9598.ENSPTRP00000050242

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]