SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000050811 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000050811
Domain Number 1 Region: 25-196
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.62e-46
Family SPRY domain 0.00019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000050811   Gene: ENSPTRG00000003613   Transcript: ENSPTRT00000006797
Sequence length 198
Comment pep:novel scaffold:CHIMP2.1.4:GL391837.1:1806760:1808448:1 gene:ENSPTRG00000003613 transcript:ENSPTRT00000006797 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
YESLLLQVSEPVNPELSAGPITGLLDRLSGFRVYFTLQPERANSHIFLCGDLRSMNVGCD
PQDDPDITAKSECFLVWGAQAFTSGKYYWEVHMGDSWNWAFGVCNNYWKEKRQNDKIDGK
EGLFLLGCVKEDTHCSLFTTSPLVVQYVPRPTSTVGLFLDCEGRTVSFVDVDQSSLIYTI
PNCSFSPPLRPIFCCSHF
Download sequence
Identical sequences H2R5F0
ENSPTRP00000050811 ENSPTRP00000050811 9598.ENSPTRP00000050811

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]