SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000052006 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000052006
Domain Number 1 Region: 297-342
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000132
Family Laminin-type module 0.038
Further Details:      
 
Domain Number 2 Region: 364-422
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000203
Family Laminin-type module 0.024
Further Details:      
 
Weak hits

Sequence:  ENSPTRP00000052006
Domain Number - Region: 420-467
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000275
Family Laminin-type module 0.019
Further Details:      
 
Domain Number - Region: 472-500
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000502
Family EGF-type module 0.034
Further Details:      
 
Domain Number - Region: 121-177
Classification Level Classification E-value
Superfamily Sialidases 0.0353
Family Sialidases (neuraminidases) 0.075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000052006   Gene: ENSPTRG00000001023   Transcript: ENSPTRT00000058949
Sequence length 539
Comment pep:known_by_projection chromosome:CHIMP2.1.4:1:108011127:108355778:1 gene:ENSPTRG00000001023 transcript:ENSPTRT00000058949 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MYLSRFLSIHALWVTVSSVMQPYPLVWGHYDLCKTQIYTEEGKVWDYMACQPESTDMTKY
LKVKLDPPDITCGDPPETFCAMGNPYMCNNECDASTPELAHPPELMFDFEGRHPSTFWQS
ATWKEYPKPLQVNITLSWSKTIELTDNIVITFESGRPDQMILEKSLDYGRTWQPYQYYAT
DCLDAFHMDPKSVKDLSQHTVLEIICTEEYSTGYTTNSKIIHFEIKDRFAFFAGPRLRNM
ASLYGQLDTTKKLRDFFTVTDLRIRLLRPAVGEIFVDELHLARYFYAISDIKVRGRCKCN
LHATVCVYDNSKLTCECEHNTTGPDCGKCKKNYQGRPWSPGSYLPIPKGTANTCIPSISS
IGNCECFGHSNRCSYIDLLNTVICVSCKHNTRGQHCELCRLGYFRNASAQLDDENVCIEC
YCNPLGSIHDRCNGSGFCECKTGTTGPKCDECLPGNSWHYGCQPNVCDNELLHCQNGGTC
HNNVRCLCPAAYTGILCEKLRCEEAGSCGSDSGQGAPPHGSPALLLLTTLLGTASPLVF
Download sequence
Identical sequences A0A2J8M4H1 A0A2K5K855 A0A2K5KW05 A0A2K5TR62 A0A2K5Z4U3 A0A2K6N740 G3RJD2 G7MIC2 Q9Y2I2
ENSP00000359085 ENSP00000359090 ENSP00000359085 ENSP00000359090 ENSPTRP00000052006 ENSP00000359082 gi|164414431|ref|NP_001106697.1| 9606.ENSP00000359085 NP_001106697.1.87134 NP_001106697.1.92137 XP_007975964.1.81039 XP_008974021.1.60992 XP_010360147.1.97406 XP_011539323.1.92137 XP_011790606.1.43180 XP_011824266.1.47321 XP_011824267.1.47321 XP_011920770.1.92194 XP_011920771.1.92194 XP_011920772.1.92194 XP_015001689.1.72884 XP_015001696.1.72884 XP_016856169.1.92137 XP_016856170.1.92137 ENSPTRP00000052006

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]