SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000052132 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000052132
Domain Number 1 Region: 40-130
Classification Level Classification E-value
Superfamily Thioredoxin-like 4.07e-16
Family Glutathione S-transferase (GST), N-terminal domain 0.0069
Further Details:      
 
Domain Number 2 Region: 217-317
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 0.0000000000000487
Family Glutathione S-transferase (GST), C-terminal domain 0.0067
Further Details:      
 
Weak hits

Sequence:  ENSPTRP00000052132
Domain Number - Region: 177-211
Classification Level Classification E-value
Superfamily SARS Nsp1-like 0.0314
Family SARS Nsp1-like 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000052132   Gene: ENSPTRG00000013515   Transcript: ENSPTRT00000059046
Sequence length 367
Comment pep:known_by_projection chromosome:CHIMP2.1.4:20:41216202:41249554:1 gene:ENSPTRG00000013515 transcript:ENSPTRT00000059046 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATPNNLTPTNCSWWPISALESDAAKPAEAPDAPEAASPAHWPRESLVLYHWTQSFSSQK
VRLVIAEKGLVCEERDVSLPQSEHKEPWFMRLNLGEEVPVIIHRDNIISDYDQIIDYVER
TFTGEHVVALMPEVGSLQHARVLQYRELLDALPMDAYTHGCILHPELTTDSMIPKYATAE
IRRHLANATTDLMKLDHEEEPQLSEPYLSKQKKLMAKILEHDDVSYLKKILGELAMVLDQ
IEAELEKRKLENEGQKCELWLCGCAFTLADVLLGATLHRLKFLGLSKKYWEDGSRPNLQS
FFERVQRRFAFRKVLGDIHTTLLSAVIPNAFRLVKRKPPSFFGASFLMGSLGGMGYFAYW
YLKKKYI
Download sequence
Identical sequences A0A2J8XW14 G3QLC5 H2R8Y1 Q96MZ0
ENSPTRP00000052132 ENSGGOP00000003274 ENSGGOP00000003274 GO.36449 ENSP00000341782 NP_076939.3.87134 NP_076939.3.92137 XP_001151420.1.37143 XP_003825967.1.60992 XP_004062236.1.27298 gi|30581160|ref|NP_076939.3| ENSP00000341782 9598.ENSPTRP00000052132 9606.ENSP00000341782 ENSPTRP00000052132 ENSP00000341782

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]