SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000052336 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000052336
Domain Number 1 Region: 219-323,426-503
Classification Level Classification E-value
Superfamily HCP-like 0.00000000418
Family HCP-like 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000052336   Gene: ENSPTRG00000000728   Transcript: ENSPTRT00000059224
Sequence length 536
Comment pep:known_by_projection chromosome:CHIMP2.1.4:1:51663214:51688028:-1 gene:ENSPTRG00000000728 transcript:ENSPTRT00000059224 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
STSLLFGRTKESMYHSLTYATILEMQAMMTFDPQDILLAGNMMKEAQMLCQRHRRKSSVT
DSFSSLVNRPTLGQFTEEEIHAEVCYAECLLQRAALTFLQDENMVSFIKGGIKVRNSYQT
YKELDSLVQSSQYCKGENHPHFEGGVKLGVGAFNLTLSMLPTRILRLLEFVGFSGNKDYG
LLQLEEGASGHSFRSVLCVMLLLCYHTFLTFVLGTGNVNIEEAEKLLKPYLNRYPKGAIF
LFFAGRIEVIKGNIDAAIRRFEECCEAQQHWKQFHHMCYWELMWCFTYKGQWKMSYFYAD
LLSKENCWSKATYIYMKAAYLSMFGKEDHKPFGDDEVELFRAVPGLKLKIAGKSLPTEKF
AIRKSRRYFSSNPISLPVPALEMMYIWNGYAVIGKQPKLTDGILEIITKAEEMLEKGPEN
EYSVDDECLVKLLKGLCLKYLGRVQEAEENFRSISANEKKIKYDHYLIPNALLELALLLM
EQDRNEEAVKLLESAKQNYKNYSMESRTHFRIQAATLQAKSSLENSSRSMVSSVSL
Download sequence
Identical sequences ENSPTRP00000052336 ENSPTRP00000052336

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]