SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000052545 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000052545
Domain Number 1 Region: 871-1170
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.41e-90
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.0000135
Further Details:      
 
Domain Number 2 Region: 215-359
Classification Level Classification E-value
Superfamily PH domain-like 1.88e-34
Family Third domain of FERM 0.0016
Further Details:      
 
Domain Number 3 Region: 107-213
Classification Level Classification E-value
Superfamily Second domain of FERM 1.7e-29
Family Second domain of FERM 0.00039
Further Details:      
 
Domain Number 4 Region: 21-106
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.07e-17
Family First domain of FERM 0.0087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000052545   Gene: ENSPTRG00000006607   Transcript: ENSPTRT00000012134
Sequence length 1174
Comment pep:known_by_projection chromosome:CHIMP2.1.4:14:87942554:88034139:-1 gene:ENSPTRG00000006607 transcript:ENSPTRT00000012134 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPLPFGLKLKRTRRYTVSSKSCLVARIQLLNNEFVEFTLSVESTGQESLEAVAQRLELRE
VTYFSLWYYNKQNQRRWVDLEKPLKKQLDKYALEPTVYFGVVFFVPSVSQLQQEITRYQY
YLQLKKDILEGSIPCTLEQAIQLAGLAVQADFGDFDQYESQDFLQKFALFPVGWLQDEKV
LEEATQKVALLHQKYRGLTAPDAEMLYMQEVERMDGYGEESYPAKDSQGSDISIGACLEG
IFVKHKNGRHPVVFRWHDIANMSHNKSFFALELANKEETIQFQTEDMETAKYIWRLCVAR
HKFYRLNQYNLQTQTVTVNPVRRRSSSRMSLPKPQPYVMPPPPQLHYNGHYTEPYASSQD
NLFVPNQNGYYCHSQTSLDRAQIDLNGRIRNGSVYSAHSTNSLNNPQPYLQPSPMSSNPS
ITGSDVMRPDYLPSHRHSALIPPSYRPTPDYETVMKQLNRGLVHAERQSHSLRNLNIGSS
YAYSRPAALVYSQPEIREHAQLPSPPAAHCPFSLSYSFHSPSPYPYPAERRPVVGAVSVP
ELTNAQLQAQDYPSPNFMRTQVYRPPPPYPPPRPANSTPDLSRHLYISSSNPDLITRRVH
HSVQTFQEDSLPVAHSLQEVSEPLTAARHAQLHKRNSIEVAGLSHGLEGLRLKERTLSAS
AAEVAPRAVSAGSQPSVFTERTQREGPEEAEGLRYGHKKSLSDATMLIHSSEEEDDEDFE
EESGARAPPARAREPRPGLAQDPPGCPRVLLAGPLHILEPKVHVPDAEKRMMDSSPVRTT
AEAQRPWRDGLLMPSMSESDLTTSGRYRARRDSLKKRPVSDLLSGKKNIVEGLPPLGGMK
KTRVDAKKIGPLKLAALNGLSLSRVPLPDEGKEVATRATNDERCKILEQRLEQGMVFTEY
ERILKKRLVDGECSTARLPENAERNRFQDVLPYDDARVELVPTKENNTGYINASHIKVSV
SGIEWDYIATQGPLQNTCQDFWQMVWEQGIAIIAMVTAEEEGGREKSFRYWPRLGSRHNT
VTYGRFKITTRFRTDSGCYATTGLKMKHLLTGQERTVWHLQYTDWPEHGCPEDLKGFLSY
LEEIQSVRRHTNSTSDPQSPNPPLLVHCSAGVGRTGVVILSEIMIACLEHNEVLDIPRVL
DMLRQQRMMLVQTLCQYTFVYRVLIQFLKSSRLI
Download sequence
Identical sequences ENSPTRP00000052545 ENSPTRP00000052545 9598.ENSPTRP00000052545

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]