SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000054088 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000054088
Domain Number 1 Region: 325-561
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 8.13e-64
Family Nuclear receptor ligand-binding domain 0.000000594
Further Details:      
 
Domain Number 2 Region: 82-166
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 8.36e-30
Family Nuclear receptor 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000054088   Gene: ENSPTRG00000032436   Transcript: ENSPTRT00000061551
Sequence length 572
Comment pep:known_by_projection chromosome:CHIMP2.1.4:1:130005524:130030313:-1 gene:ENSPTRG00000032436 transcript:ENSPTRT00000061551 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWGTGPSAGKDRMSGRPWPHPWSKSGTPSEQDRRATGLVSCEHGGGKFEGQSHQAPGPPG
GGRTGCLELLATKKTHTSQIEVIPCKICGDKSSGIHYGVITCEGCKGFFRRSQRCNAAYS
CTRQQNCPIDRTSRNRCQHCRLQKCLALGMSRDAVKFGRMSKKQRDSLHAEVQKQLQQRQ
QQQQEPVVKTPPAGAQGADTLTYTLGLPDGQLPLGSSPDLPEASACPPGLLKASGSGASY
SNNLAKAGLNGASCHLEDSPERGKAEGRESFYSTGSQLTPDRCGLRFEEHRHPGLGELGQ
GPDSYGSPSFRSTPEAPYASLTEIEHLVQSVCKSYRETCQLRLEDLLRQRSNIFSREEVT
GYQRKSMWEMWERCAHHLTEAIQYVVEFAKRLSGFMELCQNDQIVLLKAGAMEVVLVRMC
RAYNADNRTVFFEGKYGGMELFRALGCSELISSIFDFSHSLSALHFSEDEIALYTALVLI
NAHRPGLQEKRKVEQLQYNLELAFHHHLCKTHRQSILAKLPPKGKLRNLCSQHVERLQIF
QHLHPIVVQAAFPPLYKELFSTETESPVGLSK
Download sequence
Identical sequences ENSPTRP00000054088 ENSPTRP00000054088

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]