SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000054396 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000054396
Domain Number 1 Region: 47-135
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 6.87e-39
Family SCAN domain 0.0000536
Further Details:      
 
Domain Number 2 Region: 533-589
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.03e-26
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 3 Region: 644-701
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.57e-24
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 4 Region: 476-533
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.85e-23
Family Classic zinc finger, C2H2 0.0039
Further Details:      
 
Domain Number 5 Region: 588-645
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.02e-22
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 6 Region: 435-486
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.18e-18
Family Classic zinc finger, C2H2 0.0073
Further Details:      
 
Domain Number 7 Region: 686-738
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.09e-18
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 8 Region: 169-224
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.00000000000000103
Family KRAB domain (Kruppel-associated box) 0.0025
Further Details:      
 
Weak hits

Sequence:  ENSPTRP00000054396
Domain Number - Region: 366-408
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000258
Family Classic zinc finger, C2H2 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000054396   Gene: ENSPTRG00000021253   Transcript: ENSPTRT00000061852
Sequence length 745
Comment pep:novel chromosome:CHIMP2.1.4:9:110467452:110485079:1 gene:ENSPTRG00000021253 transcript:ENSPTRT00000061852 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQAVVPLNKMTAISPEPQTLASTEQNEVPRVVTSGEQEAILRGNAADAESFRQRFRWFCY
SEVAGPRKALSQLWELCNQWLRPDIHTKEQILELLVFEQFLTILPGEIRIWVKSQHPESS
EEVVTLIEDLTQMLEEKEDPVSQDSTVSQEENSKEDKMVTVCPNTESCESITLKDVAVTF
SRGEWKKLEPFQKELYKEVLLENLRNLEFLDFPVSKLELISQLKWVELPWLLEEVSKGSR
LDESALDKIIERCLRDDDHGLMEESQQYCGSSEEDHGNQGNSKGRVAQNKTLGSGSRGKK
FDPDKSPFGHNFKETSDLIKHLRVYLRKKSRRYNESKKPFSFHSDLVLNRKEKTAGEKSR
KSNDGGKVLSHSSALTEHQKRQKIHLGDRSQKCSKCGIIFIRRSTLSRRKTPMCEKCRKD
SCQEAALNKDEGNESGEKTHKCSKCGKAFGYSASLTKHRRIHTGEKPYMCNECGKAFSDS
SSLTPHHRTHSGEKPFKCDDCGKGFTLSAHLIKHQRIHTGEKPYKCKDCGRPFSDSSSLI
QHQRIHTGEKPYTCSNCGKSFSHSSSLSKHQRIHTGEKPYKCGECGKAFRQNSCLTRHQR
IHTGEKPYLCNDCGMTFSHFTSVIYHQRLHSGEKPYKCNQCEKAFPTHSLLSRHQRIHTG
VKPYKCKECGKSFSQSSSLNEHHRIHTGEKPYECNYCGATFSRSSILVEHLKIHTGRREY
ECNECEKTFKSNSGLIRHRGFHSAE
Download sequence
Identical sequences A0A2J8LPE8
ENSPTRP00000054396 XP_003810917.1.60992 XP_014201720.1.60992 XP_016816909.1.37143 XP_528388.4.37143 ENSPTRP00000054396

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]