SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000054547 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000054547
Domain Number 1 Region: 279-451
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.42e-41
Family SPRY domain 0.00023
Further Details:      
 
Domain Number 2 Region: 5-80
Classification Level Classification E-value
Superfamily RING/U-box 6.85e-18
Family RING finger domain, C3HC4 0.017
Further Details:      
 
Domain Number 3 Region: 85-148
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 8.55e-16
Family B-box zinc-binding domain 0.0018
Further Details:      
 
Weak hits

Sequence:  ENSPTRP00000054547
Domain Number - Region: 178-244
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00576
Family Spectrin repeat 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000054547   Gene: ENSPTRG00000003591   Transcript: ENSPTRT00000061997
Sequence length 452
Comment pep:known_by_projection chromosome:CHIMP2.1.4:11:49136688:49143035:1 gene:ENSPTRG00000003591 transcript:ENSPTRT00000061997 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNSGILQIFQRELICPICMNYFIDPVTVDCGHSFCRPCFYLNWKDSPFLVQCSECTKSTG
QINLKTNIHFKKMASLARKVSLWLFLSSEEQMCGTHRETKKMFCEVDRSLLCLLCSSSQE
HRDHRHCPIESAAEEHREKLLQKMQSLWEKACENHRNLNVETTRTRCWKDYVNLRLEAIR
AEYQKMPAFHHEEEKHNLEMLKKKGKDIFHRLHLSKAKMAHRMEILRGMYEELNEMCHKP
DVELLQAFGDILHRSESVLLHMPQPLNPELSAGPITGLRDRLNQFRVHITLYHEEANSDI
FLYGILKSMCIGCDHQDVPYFTATPGSFLAWGAQTFTSGKYYWEVHVGDSWNWAFGVCNM
YWKEKNQNEKIDGEEGLFLLGCVKNDIQRSLFTTSPLMLQYIPRPTSRVGLFLDCEAKTV
SFVDVNQSSLIYTIPNCSFSPPLRPIFCCFHF
Download sequence
Identical sequences A0A2J8J3V4
ENSPTRP00000054547 9598.ENSPTRP00000054547 ENSPTRP00000054547

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]