SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000054795 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000054795
Domain Number 1 Region: 419-672
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 3.5e-72
Family Eukaryotic proteases 0.00000000115
Further Details:      
 
Domain Number 2 Region: 2-111
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.66e-30
Family Spermadhesin, CUB domain 0.000000472
Further Details:      
 
Domain Number 3 Region: 163-275
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 6.15e-20
Family Spermadhesin, CUB domain 0.00013
Further Details:      
 
Domain Number 4 Region: 347-423
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000584
Family Complement control module/SCR domain 0.0000167
Further Details:      
 
Domain Number 5 Region: 286-350
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000737
Family Complement control module/SCR domain 0.0017
Further Details:      
 
Domain Number 6 Region: 129-162
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000816
Family EGF-type module 0.00059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000054795   Gene: ENSPTRG00000004605   Transcript: ENSPTRT00000062240
Sequence length 673
Comment pep:known_by_projection chromosome:CHIMP2.1.4:12:7229965:7239966:1 gene:ENSPTRG00000004605 transcript:ENSPTRT00000062240 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MYGEILSPNYPQAYPSEVEKSWDIEVPEGYGIHLYFTHLDIELSENCAYDSVQIISGDTE
EGRLCGQRSSNNPHSPIVEEFQVPYNKLQVIFKSDFSNEERFTGFAAYYVATELKCSVHE
KSGLPEPRNVPCSHFCNNFIGGYFCSCPPEYFLHDDMKNCGVNCSGDVFTALIGEIASPN
YPKPYPENSRCEYQIRLEKGFQVRLALLLKLECSGAITAHCSLDLLGSSKRDRQFGPYCG
HGFPGPLNIETKSNALDIIFQTDLTGQKKGWKLRYHGDPMPCPKEDTPNSVWEPVKAKYV
FRDVVQITCLDGFEVVEGRVGATSFYSTCQSNGKWSNSKLKCQPVDCGIPESIENGKVED
PESTLFGSVIRYTCEEPYYYMENGGGERESEKALYHCAGNGSWVNEVLGPELPKCVPVCG
VPREPFEEKQRIIGGSDADIKNFPWQVFFDNPWAGGALIDEYWVLTAAHVVEGNREPTMY
VGSTSVQTSRLAKSKMLTPEHVFIHPGWKLLEVPEGRTNFDNDIALVRLKDPVKMGPTVS
PICLPGTSSDYNLMDGDLGLISGWGRTEKRDRAVRLKAARLPVAPLRKCKEKPTADAEAY
VFTPNMICAGGEKGMDSCKGDSGGAFAVQDPNDKTKFYAAGLVSWGPQCGTYGLYTRVKN
YVDWILKTMQENS
Download sequence
Identical sequences ENSPTRP00000054795 ENSPTRP00000054795

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]