SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000056372 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000056372
Domain Number 1 Region: 62-163
Classification Level Classification E-value
Superfamily Ubiquitin-like 8.86e-24
Family Ras-binding domain, RBD 0.005
Further Details:      
 
Domain Number 2 Region: 962-1066
Classification Level Classification E-value
Superfamily PDZ domain-like 1.71e-23
Family PDZ domain 0.0000103
Further Details:      
 
Domain Number 3 Region: 249-356
Classification Level Classification E-value
Superfamily SMAD/FHA domain 6.78e-16
Family FHA domain 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000056372   Gene: ENSPTRG00000018877   Transcript: ENSPTRT00000064812
Sequence length 1078
Comment pep:known_by_projection chromosome:CHIMP2.1.4:7:3464093:3548898:-1 gene:ENSPTRG00000018877 transcript:ENSPTRT00000064812 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFYGTHFIMSPPTKSKLKRQSQLLSSMLSRTLSYKYRDLDSTFSSLGASDDPAELSTQLS
APGVLKVFGDSVCTGTHYKSVLATGTSSARELVKEALERYALDPRQAGQYVLCDVVGQAG
DAGQRWQARCFRVFGDSEKPLLIQELWKPREGLSRRFELRKKSDVEELAAKEVDTITAGI
NAQARRLQRSRAKGTPALALGDARSSPPPRLRRTVSETSLSPVNALPAAAQGPEEPGPDA
MRYSLYQSPHLLLLQGYSQQHDSLVYVLNRDRHTVGQRTPSSKPSISLSAPDILPLHCTI
RRQPLPDSGQAGGRLVLEPIPGAPISVNFSEVGHRTVVLHHGDLLSLGLYYLLLFKDPAQ
AQPLPARALARLRAVPQSCRLCGAALGARGAASPTQAALPRRQQLLLEFEPHLEDTLLQR
IMTLIEPGGDDHKLTPAFLLCLCIQYSATHFEPGTFGQLLLKIARRIRETVWEKTKELAE
KQAQLQEPISLASCAMADLVPDLQPILFWMSNSIELLYFIQQKCPLYMQSMEEQLDITGS
KESLFSCTLTASEEAMAVLEEVVLYAFQQCVYYVSKSLYICLPALLECPPFQTERRESWS
SAPELPEELRRVVSVYQAALDLLRQLQVHPEVASQMLAYLFFFSGTLLLNQLLDRGPSLS
CFHWPRGVQACARLQQLLEWMRSAGFGAAGEHFFQKLSCTLNLLATPRAQLIQMSWTALR
AAFPALSPAQLHQLLTHYQLASAMGPMSAWEPGAQDSPEAFRSEDVLESYENPPPIVLPS
DGFQVDLEADCLDDSIYQHLLYIRHFLWGLRSRASPGSPGSPGRPGSGASQPVCPEGMHH
VVLDGHLEAPSCPLAPRDPGPAAREVAPERTLPLRGAPWAQAPPGRQPGRGGSQAGPPHT
DSSCLLTPPSTPLGPEPGDPDWAESGGPCGKALPERQRNGPSGLRGAAPEGDSAALADES
PPAPSSRSSSTEDFCYVFTVELERGPSGLGMGLIDGMHTHLGAPGLYIQTLLPGSPAAAD
GRLSLGDRILEVNGSSLLGLGYLRAVDLIRHGGKKMRFLVAKSDVETAKKIHFRTPPL
Download sequence
Identical sequences ENSPTRP00000056372 ENSPTRP00000056372

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]