SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000056389 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000056389
Domain Number 1 Region: 629-903
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 3.26e-99
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.00000588
Further Details:      
 
Domain Number 2 Region: 215-361
Classification Level Classification E-value
Superfamily PH domain-like 1.44e-35
Family Third domain of FERM 0.00017
Further Details:      
 
Domain Number 3 Region: 112-217
Classification Level Classification E-value
Superfamily Second domain of FERM 3.53e-33
Family Second domain of FERM 0.00018
Further Details:      
 
Domain Number 4 Region: 27-112
Classification Level Classification E-value
Superfamily Ubiquitin-like 7.83e-21
Family First domain of FERM 0.0025
Further Details:      
 
Domain Number 5 Region: 508-597
Classification Level Classification E-value
Superfamily PDZ domain-like 6.7e-20
Family PDZ domain 0.0000991
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000056389   Gene: ENSPTRG00000021240   Transcript: ENSPTRT00000064828
Sequence length 913
Comment pep:known chromosome:CHIMP2.1.4:9:108305967:108391811:-1 gene:ENSPTRG00000021240 transcript:ENSPTRT00000064828 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTSRLRALGGRINNIRTSELPKEKTRSEVICSIHFLDGVVQTFKVTKQDTGQVLLDMVYN
HLGVTEKEYFGLQHDDDSVDSPRWLEASKPIRKQLKGGFPCTLHFRVRFFIPDPNTLQQE
QTRHLYFLQLKMDICEGRLTCPLNSAVVLASYAVQSHFGDYNSSIHHPGYLSDSQFIPDQ
NEDFLTKVESLHEQHSGLKQSEAESCYINIARTLDFYGVELHSGRDLHNLDLMIGIASAG
VAVYRKYICTSFYPWVNILKISFKRKKFFIHQRQKQAESREHIVAFNMLNYRSCKNLWKS
CVEHHTFFQAKKLLPQEKNVLSQYWTMGSRNTKKSVNNQYCKKVIGGMVWNPAMRRSLSV
EHLETKSLPSRSPPITPNWRSPRLRHEIRKPRHSSADNLANEMTYITETEDVFYTYKGSL
APQDSDSEVSQNRSPHQESLSENNPAQSYLTQKSSSSVSPSSNAPGSCSPDGVDQQLLDD
FHRVTKGGSTEDASQYYCDKNDNGDGYLVLIRITPDEDGKFGFNLKGGVDQKMPLVVSRI
NPESPADTCIPKLNEGDQIVLINGRDISEHTHDQVVMFIKASRESHSRELALVIRRRAVR
SFADFKSEDELNQLFPEAIFPMCPEGGDTLEGSMAQLKKGLESGTVLIQFEQLYRKKPGL
AITFAKLPQNLDKNRYKDVLPYDTTRVLLQGNEDYINASYVNMEIPAANLVNKYIATQGP
LPHTCAQFWQVVWDQKLSLIVMLTTLTERGRTKCHQYWPDPPDVMNHGGFHIQCQSEDCT
IAYVSREMLITNTQTGEEHTVTHLQYVAWPDHGVPDDSSDFLEFVNYVRSLRVDSEPVLV
HCSAGIGRTGVLVTMETAMCLTERNLPIYPLDIVRKMRDQRAMMVQTSSQYKFVCEAILR
VYEEGLVQMLDPS
Download sequence
Identical sequences K7CLP4
XP_008961520.1.60992 XP_520179.2.37143 ENSPTRP00000056389 ENSPTRP00000056389

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]