SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000057729 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000057729
Domain Number 1 Region: 11-106
Classification Level Classification E-value
Superfamily Immunoglobulin 1.29e-21
Family I set domains 0.011
Further Details:      
 
Domain Number 2 Region: 127-232
Classification Level Classification E-value
Superfamily Immunoglobulin 4.94e-20
Family I set domains 0.011
Further Details:      
 
Domain Number 3 Region: 251-338
Classification Level Classification E-value
Superfamily Immunoglobulin 1.82e-19
Family I set domains 0.01
Further Details:      
 
Domain Number 4 Region: 1352-1444
Classification Level Classification E-value
Superfamily Immunoglobulin 1.21e-17
Family I set domains 0.011
Further Details:      
 
Domain Number 5 Region: 1620-1704
Classification Level Classification E-value
Superfamily Immunoglobulin 1.98e-17
Family V set domains (antibody variable domain-like) 0.056
Further Details:      
 
Domain Number 6 Region: 1812-1894
Classification Level Classification E-value
Superfamily Immunoglobulin 3.42e-17
Family I set domains 0.023
Further Details:      
 
Domain Number 7 Region: 798-891
Classification Level Classification E-value
Superfamily Immunoglobulin 5.12e-16
Family I set domains 0.019
Further Details:      
 
Domain Number 8 Region: 1162-1262
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000338
Family I set domains 0.03
Further Details:      
 
Domain Number 9 Region: 979-1074
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000849
Family I set domains 0.03
Further Details:      
 
Domain Number 10 Region: 889-984
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000024
Family I set domains 0.037
Further Details:      
 
Domain Number 11 Region: 1070-1156
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000361
Family I set domains 0.044
Further Details:      
 
Domain Number 12 Region: 332-427
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000971
Family I set domains 0.019
Further Details:      
 
Domain Number 13 Region: 1449-1534
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000116
Family I set domains 0.017
Further Details:      
 
Domain Number 14 Region: 719-810
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000198
Family I set domains 0.017
Further Details:      
 
Domain Number 15 Region: 1721-1807
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000337
Family I set domains 0.0042
Further Details:      
 
Domain Number 16 Region: 1258-1353
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000167
Family I set domains 0.026
Further Details:      
 
Domain Number 17 Region: 1541-1629
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000142
Family I set domains 0.0031
Further Details:      
 
Domain Number 18 Region: 514-603
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000135
Family Fibronectin type III 0.0043
Further Details:      
 
Domain Number 19 Region: 432-541
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000416
Family I set domains 0.0083
Further Details:      
 
Weak hits

Sequence:  ENSPTRP00000057729
Domain Number - Region: 618-715
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000914
Family I set domains 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000057729   Gene: ENSPTRG00000012963   Transcript: ENSPTRT00000066153
Sequence length 1895
Comment pep:known_by_projection chromosome:CHIMP2.1.4:2B:224634019:224654812:-1 gene:ENSPTRG00000012963 transcript:ENSPTRT00000066153 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKASSGDQGSPPCFLRFPRPVRVVSGAEAELKCVVLGEPPPVVVWEKGGQQLAASERLSF
PADGAEHGLLLSAALPTDAGVYVCRARNAAGEAYAAAAVTVLEPPASDPELQPAERPLPS
PGSGEGAPVFLTGPRSQWVLRGAEVVLTCRAGGLPEPTLYWEKDGMALDEVWDSSHFALE
QGLEDGPGASLALRILAARLPDSGVYVCHARNAHGHAQAGALLQVHQPPESPPADPDEAP
APVVEPLKCAPKTFWVNEGKHAKFRCYVMGKPEPEIEWHWEGRPLLPDRRRLMYRDRDGG
FVLKVLYCQAKDRGLYVCAARNSAGQTLSAVQLHVKEPRLRFTRPLQDVEGREHGIAVLE
CKVPNSRIPTAWFREDQRLLPCRKYEQIEEGTVRRLIIHRLKADDDGIYLCEMRGRVRTV
ANVTVKGPILKRLPRKLDVLEGENAVLLVETLEAGVEGRWSRDGEELPVICQSSSGHMHA
LVLPGVTREDAGEVTFSLGNSRTTTLLRVKCVKHSPPGPPISAEMFKGHKNTVLLTWKPP
EPAPETPFIYRLERQEVGSEDWIQCFSIEKAGAVEVPGDCVPSEGDYRFRICTVSGHGRS
PHVVFHGSAHLVPTARLVAGLEDVQVYDGEDAVFSLDLSTIIQGTWFLNGEELKSNEPEG
QVEPGALRYCMEQKGLQHRLILHAVKHQDSGALVGFSCPGVQDSAALTIQESPVHILSPQ
DKVSLTFTTSERVVLTCELSRVDFPATWYKDGQKVEDSELLVVKMDGRKHRLILPEAKVQ
DSGEFECRTEGVSAFFGVTVQDPPVHIVDPREHVFVHAITSECVMLACEVDREDAPVRWY
KDGQEVEESDFVVLENEGPHRRLVLPATQPSDGGEFQCVAGDERAYFTVTITDVSSWIVY
PSGKVYVAAVRLERVVLTCELCRPWAEVRWTKDGEEVVESPALLLQKEDTVRRLVLPAVQ
LEDSGEYLCEIDDESASFTVTVTEPPVRIIYPRDEVTLIAVTLECVVLMCELSREDAPVR
WYKDGLEVEESEALVLERDGPRCRLVLPAAQPEDGGEFVCDAGDDSAFFTVTVTAPPERI
VHPAARSLDLHFGAPGRVELRCEVAPAGSQVRWYKDGLEVEASDALQLGAEGPTRTLTLP
HAQPEDAGEYVCETRDEAITFNVILAEPPVQFLAPETTPSPLCVAPGEPVVLSCELSRAG
APVVWSHNGRPVQEGEGLELHAEGPRRVLCIQAAGPAHAGLYTCQSGAAPGAPSLSFTVQ
VAEPPVRVVAPEAAQTRVRSTPGGDLELVVHLSGPGGPVRWYKDGERLASQGRVQLEQAG
ARQVLRVQGARSRDAGEYLCDAPQDSRIFLVSVEEPLPVKLVSELTPLTVHEGDDATFRC
EVSPPDADVTWLRNGAVVTPGPQAEMAQNGSSRILTLRGCQLGDAGTVTVRAGITATSAR
LHVRETELLFLRRLQDVRAEEGQDVCLEVETGRVGTAGAVRWVRGGQPLPHDSRLSMAQD
GHIHRLFIHGVILADQGTYGCESHHDRTLARLSVRPRQLRVLRPLEDVTISEGGSATFQL
ELSQEGVTGEWARGGVRLYPGPKCHIHSDGHRHRLVLNSLGLADSGCVSFTADSLRCAAR
LIVREVPVTIVRGPHDLEVTEGDTATFECELSQALADVTWEKDGSALTPSPRLWLQALGT
RRLLQLRRCGPSDAGTYSCAVGTARARPVRLTVRERTVAVLSELRSVSAREGDGATFECT
VSEVEITGRWELGGRPLRPGARVRIRQEGKKHILVLSELRAEDAGEVRFQAGPAQSLALL
EVEALPLQMCRHPPREKTVLVGRRAVLEVTVSRSGGHVCWLREGAELCPGDKYEMRSHGP
THSLVIHDVRPEDQGTYCCQAGQDSTHTRLLVEGN
Download sequence
Identical sequences H2RCR6
XP_003309516.1.37143 ENSPTRP00000057729 ENSPTRP00000057729

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]