SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000059846 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000059846
Domain Number 1 Region: 56-88
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.000000000114
Family CCCH zinc finger 0.00024
Further Details:      
 
Domain Number 2 Region: 28-51
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.00000392
Family CCCH zinc finger 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000059846   Gene: ENSPTRG00000030712   Transcript: ENSPTRT00000076313
Sequence length 243
Comment pep:known_by_projection chromosome:CHIMP2.1.4:14:67952950:67955947:-1 gene:ENSPTRG00000030712 transcript:ENSPTRT00000076313 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTTTLVSATIFDLSEVLCKRLLPTKQPFEENGACKYGDKCQFAHGIHELRSLTRHPKYKT
ELCRTFHTIGFCPYGPRCHFIHNAEERRALAGARDLSADRPRLQHSFSFAGFPSAAATAA
ATGLLDSPTSITPPPILSADDLLGSPTLPDGTNNPFAFSSQELASLFAPSMGLPGGGSPT
TFLFRPMSESPHMFDSPPSPQDSLSDQEGYLSSSSSSHSGSDSPTLDNSRRLPIFSRLSI
SDD
Download sequence
Identical sequences ENSPTRP00000059846

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]