SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000059854 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000059854
Domain Number 1 Region: 88-270
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.94e-63
Family SPRY domain 0.000000185
Further Details:      
 
Domain Number 2 Region: 7-77
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000000019
Family RING finger domain, C3HC4 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000059854   Gene: ENSPTRG00000039431   Transcript: ENSPTRT00000074533
Sequence length 271
Comment pep:novel chromosome:CHIMP2.1.4:19:60804018:60805339:1 gene:ENSPTRG00000039431 transcript:ENSPTRT00000074533 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEHFKQASSCPMCLDYLENPMHLKCGYVCCLRCMNSLRKGPDGKGVLCPFCPVVSQKND
IRPAAQLGALVPKIKELEPKVRAVLQMNPRMRKFQVDMTLDVDTANNYLIISEDLRRVRC
GNFRQNRKEQAERFDTALCVLGTPRFTSGRHYWEVDVGTSKVWDVGVCKESVNRQGNVVL
SSELGFWTVGLREGQIYFASTKPVTGLWVSPGLHRVGIYLDIKMRAISFYNVSDRSHIFT
FTKISATEPLRPCFAHADTSRDDHGYLSVCV
Download sequence
Identical sequences ENSPTRP00000059854 ENSPTRP00000059854

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]