SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000059899 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000059899
Domain Number 1 Region: 410-467
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000124
Family Complement control module/SCR domain 0.0018
Further Details:      
 
Domain Number 2 Region: 339-385
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000602
Family TSP-1 type 1 repeat 0.00066
Further Details:      
 
Domain Number 3 Region: 26-73
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000811
Family TSP-1 type 1 repeat 0.0021
Further Details:      
 
Domain Number 4 Region: 78-119
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000302
Family LDL receptor-like module 0.0017
Further Details:      
 
Weak hits

Sequence:  ENSPTRP00000059899
Domain Number - Region: 291-329
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00151
Family EGF-type module 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000059899   Gene: ENSPTRG00000016824   Transcript: ENSPTRT00000073093
Sequence length 486
Comment pep:novel chromosome:CHIMP2.1.4:5:74132579:74195394:-1 gene:ENSPTRG00000016824 transcript:ENSPTRT00000073093 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKVISLFILVGFIGEFQSFSSASSPVNCQWDSYAPWSECNGCTKTQTRRRSVAVYGQYGG
QPCAGNAFETQSCEPTRGCPTEEGCGERFRCFSGQCISKSLVCNGDSDCDEDSADEDRCE
DSERRTSCDIDKPPPNIELTGNGYNELTGQFRNRVLFYVDSEKLKQNDFNSVEEKKCKSS
GWHFVVKFSSHGCKELENALKAASGTQNNVLRGDPFIRGGGAGFISGLSYLELDNPAGNK
RRYSAWAESVTNLPQVIKQKLTPLYELVKEVPCASVKKLYLKWALEEYLDEFDPCHCRPC
QNGGLATVEGTHCLCHCKPYTFGAACEQGVLVGNQAGGVDGGWSCWSSWSPCVQGKKTRS
RECNNPPPSGGGRSCVGETTESTQCEDEELEHLRLLEPHCFPLSLVPTEFCPSPPALKDG
FVQDEGTMFPVGKNVVYTCNEGYSLIGNPVARCGEDLRWLVGEMHCQNGKISNWMKVNET
LLVEHH
Download sequence
Identical sequences ENSPTRP00000059899

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]