SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000060075 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000060075
Domain Number 1 Region: 212-334
Classification Level Classification E-value
Superfamily Growth factor receptor domain 3.22e-17
Family Growth factor receptor domain 0.018
Further Details:      
 
Domain Number 2 Region: 170-220
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000182
Family EGF-type module 0.012
Further Details:      
 
Weak hits

Sequence:  ENSPTRP00000060075
Domain Number - Region: 333-376
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00042
Family EGF-type module 0.018
Further Details:      
 
Domain Number - Region: 40-71
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000742
Family EGF-type module 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000060075   Gene: ENSPTRG00000040728   Transcript: ENSPTRT00000073036
Sequence length 493
Comment pep:known_by_projection chromosome:CHIMP2.1.4:18:46074866:46076872:1 gene:ENSPTRG00000040728 transcript:ENSPTRT00000073036 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLKALFLTMLTLALVKSQDTEETITYTQCTDGYEWDPVRQQCKDIDECDIVPDACKGGMK
CVNHYGGYLCLPKTAQIIVNNEQPQQETQPAEGTSGATTGVVAASSMATSGVLPGGGFVA
SAAAVAGPEMQTGRNNFVIRRNPADPQRIPSNPSHRIQCAAGYEQSEHNVCQDIDECTAG
THNCRADQVCINLRGSFACQCPPGYQKRGEQCVDIDECTIPPYCHQRCVNTPGSFYCQCS
PGFQLAANNYTCVDINECDASNQCAQQCYNILGSFICQCNQGYELSSDRLNCEDIDECRT
SSYLCQYQCVNEPGKFSCMCPQGYQVVRSRTCQDINECETTNECREDEMCWNYHGGFRCY
PRNPCQDPYILTPENRCVCPVSNAMCRELPQSIVYKYMSIRSDRSVPSDIFQIQATTIYA
NTINTFRIKSGNENGEFYLRQTSPVSAMLVLVKSLSGPREHIVDLEMLTVSSIGTFRTSS
VLRLTIIVGPFSF
Download sequence
Identical sequences A0A0S2Z4F1 H2REY4 Q12805
gi|86788015|ref|NP_001034437.1| gi|86788132|ref|NP_001034438.1| ENSP00000347596 ENSP00000378058 NP_001034437.1.87134 NP_001034437.1.92137 NP_001034438.1.87134 NP_001034438.1.92137 XP_016804050.1.37143 XP_016804051.1.37143 XP_016804052.1.37143 ENSP00000347596 ENSPTRP00000060075 ENSP00000347596 ENSP00000378057 ENSP00000378058 9598.ENSPTRP00000020509 9606.ENSP00000347596 ENSPTRP00000060075

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]