SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000060323 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000060323
Domain Number 1 Region: 288-338
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.39e-18
Family Classic zinc finger, C2H2 0.0058
Further Details:      
 
Domain Number 2 Region: 330-383
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000161
Family Classic zinc finger, C2H2 0.0097
Further Details:      
 
Domain Number 3 Region: 246-298
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000145
Family Classic zinc finger, C2H2 0.017
Further Details:      
 
Domain Number 4 Region: 373-412
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000057
Family Classic zinc finger, C2H2 0.022
Further Details:      
 
Weak hits

Sequence:  ENSPTRP00000060323
Domain Number - Region: 157-181,211-238
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00115
Family Classic zinc finger, C2H2 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000060323   Gene: ENSPTRG00000016087   Transcript: ENSPTRT00000072722
Sequence length 458
Comment pep:known_by_projection chromosome:CHIMP2.1.4:4:73019969:73059556:-1 gene:ENSPTRG00000016087 transcript:ENSPTRT00000072722 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATQVMGQSSGGGGLFTSSGNIGMALTNDMYDLHDLSKAELAAPQLIMLANVALTGEVNG
SCCDYLVGEERQMAELMPVGDNNFSDSEEGEGLEESAEIKGEPHGLENMELRSLELSVVE
PQPVFEASGAPEIYSSNKDLPPETPGAEDKGKSSKTKPFRCKPCQYEAESEEQFVHHIRV
HSAKKFFVEESAEKQAKARESGSSTAEEGDFSKGPIRCDRCGYNTNRYDHYTAHLKHHTR
AGDNERVYKCIICTYTTVSEYHWRKHLRNHFPRKVYTCGKCNYFSDRKNNYVQHVRTHTG
ERPYKCELCPYSSSQKTHLTRHMRTHSGEKPFKCDQCSYVASNQHEVTRHARQVHNGPKP
LNCPHCDYKTADRSNFKKHVELHVNPRQFNCPVCDYAASKKCNLQYHFKSKHPTCPNKTM
DVSKVKLKKTKKREADLPDNITNEKAEIEQTKKKKKKK
Download sequence
Identical sequences ENSPTRP00000060323

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]