SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000060355 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000060355
Domain Number 1 Region: 50-175
Classification Level Classification E-value
Superfamily RNI-like 0.000000000128
Family Cyclin A/CDK2-associated p19, Skp2 0.045
Further Details:      
 
Domain Number 2 Region: 2-38
Classification Level Classification E-value
Superfamily F-box domain 0.0000000107
Family F-box domain 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000060355   Gene: ENSPTRG00000041241   Transcript: ENSPTRT00000076260
Sequence length 181
Comment pep:novel chromosome:CHIMP2.1.4:16:66482131:66499095:-1 gene:ENSPTRG00000041241 transcript:ENSPTRT00000076260 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAESLPLEMLTYILSFLPLSDQKEASLVSWAWYRAAQNALRESLGLRGICCISLTNLDGS
LASNQVLQSVAYHLGPHLQSLSLGGGSPTEASSVALILGCPALCVLDLSGCNSLFTSGIL
LAQPEMAQSVQQALSGLCELNLAGLRDLADLSFNRLSSCAPSLERLSLAYCHLTFELGPA
R
Download sequence
Identical sequences ENSPTRP00000060355 ENSPTRP00000060355

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]