SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000060365 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000060365
Domain Number 1 Region: 450-507
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.91e-23
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 
Domain Number 2 Region: 394-451
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.18e-22
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 
Domain Number 3 Region: 170-225
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.13e-22
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 4 Region: 47-100
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.83e-21
Family KRAB domain (Kruppel-associated box) 0.00043
Further Details:      
 
Domain Number 5 Region: 282-339
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.44e-21
Family Classic zinc finger, C2H2 0.0091
Further Details:      
 
Domain Number 6 Region: 230-283
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.23e-20
Family Classic zinc finger, C2H2 0.015
Further Details:      
 
Domain Number 7 Region: 339-395
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.71e-20
Family Classic zinc finger, C2H2 0.0095
Further Details:      
 
Domain Number 8 Region: 496-548
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.93e-20
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000060365   Gene: ENSPTRG00000041125   Transcript: ENSPTRT00000074179
Sequence length 550
Comment pep:novel chromosome:CHIMP2.1.4:19:12289268:12302391:-1 gene:ENSPTRG00000041125 transcript:ENSPTRT00000074179 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRWGVLSYLGLYLSEDEGAGTAHGVRKTTVPLLAVRSKFGRRQIFEVKDSVAFEDVAVNF
TQEEWALLDPSQKNLYREVMQETLRNLTSIGKKWNNQYIEDEHQNPKRNLRRLIGERLSE
SKESHQHGEVLTQVPDDTLKKKTPGVQSYESSVCGEIGIGLSSLNRHLRAFSYSSSLAIH
GRTHTGEKPYECKECGKAFRFPSSVRRHERIHSAKKPYECKQCGKALSYLVSFQTHMRMH
TGERPHKCNICGKAFFSPSSLKRHEKSHTGEKRYKCKQCDKAFNCPSSFQYHERTHSGEK
PYECTQCRKAFRSVKYLRVHERKHTGEKPYECKLCGKGFISSTSFCYHEKTHTGEKPYEC
KKCEKAFSFVKDLQIHERTHTGEKPFECKQCGKTFTSSNSFHYHERTHTGEKPYECKQCG
KAFRSASILQKHIRTHTGEKPYGCKQCGKVFRVASQLKMHERTHTGEKPYECKRCGKAFI
SSNSIRYHKRTHTGEKPYKCKQCGKAFISSNSFLYHERIHTGEKPYECKQCGKAFRSVSI
LQKHVRTHAG
Download sequence
Identical sequences ENSPTRP00000060365 ENSPTRP00000060365

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]