SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000061275 from Pan troglodytes 76_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000061275
Domain Number 1 Region: 151-293
Classification Level Classification E-value
Superfamily C-type lectin-like 8.92e-27
Family C-type lectin domain 0.0008
Further Details:      
 
Domain Number 2 Region: 1-49
Classification Level Classification E-value
Superfamily PR-1-like 0.00000000249
Family PR-1-like 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000061275   Gene: ENSPTRG00000008293   Transcript: ENSPTRT00000076059
Sequence length 303
Comment pep:novel scaffold:CHIMP2.1.4:GL392552.1:42172:47696:-1 gene:ENSPTRG00000008293 transcript:ENSPTRT00000076059 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LVWATSSQLGCGRHLCSAGQTAIEAFVCAYSPGGNWEVNGKTIVPYKKGAWCSLCTASVS
GCFKAWDHAGGLCEVPRNPCRMSCQNHGRLNISTCHCHCPPGYTGRYCQVRCSLQCVHGR
FREEECSCVCDIGYGGAQCATKVHFPFHTCDLRIDGDCFMVSSEADTYYRARMKCQRKGG
VLAQIKSQKVQDILAFYLGHLETTNEVIDSDFETRNFWIGLTYKTAKDSFRWATGEHQAF
TSFAFGQPDNHGLVWLSAAMGFGNCVELQASAAFNWNDQRCKTRNRYICQFAQEHISLWG
LGS
Download sequence
Identical sequences ENSPTRP00000061275 ENSPTRP00000061275

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]