SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPTRP00000000195 from Pan troglodytes 69_2.1.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPTRP00000000195
Domain Number 1 Region: 26-139
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000863
Family Growth factor receptor domain 0.012
Further Details:      
 
Weak hits

Sequence:  ENSPTRP00000000195
Domain Number - Region: 135-158
Classification Level Classification E-value
Superfamily TNF receptor-like 0.00228
Family TNF receptor-like 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPTRP00000000195   Gene: ENSPTRG00000000101   Transcript: ENSPTRT00000000233
Sequence length 255
Comment pep:known chromosome:CHIMP2.1.4:1:7927343:7948789:-1 gene:ENSPTRG00000000101 transcript:ENSPTRT00000000233 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGNSYYNIVATLLLVLNFERTRSLQDPCSNCPAGTFCDNNRNQICSPCPPNSFSSAGGQR
TCDICRQCKGVFRTRKECSSTSNAECDCTPGFHCLGAGCSMCEQDCKQGQELTKKGCKDC
CFGTFNDQKRGICRPWTNCSLDGKSVLVNGTKERDVVCGPSPADLSPGASSATPPAPARE
PGHSPQIISFFLALTSTALLFLLFFLMLRFSVVKRGRKKLLYIFKQPFMRPVQTTQEEDG
CSCRFPEEEEGGCEL
Download sequence
Identical sequences A0A2I3TV61
ENSPTRP00000000195 9598.ENSPTRP00000000195 ENSPTRP00000000195 XP_016808930.1.37143

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]